StarFunc result for job id Q9HCX4

User Input

>input (862 residues)
MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVR
KMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVR
IVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIV
HILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVL
TALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVW
SDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSI
GLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET
FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLS
IFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIIS
EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNL
YSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTM
VVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYY
LIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
QKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ
LSEKFGKNLNKDHLRVNKGKDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LQF7	0.975	0.975	0.000	862	0.984	0.984	F1LQF7.pdb.gz	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
2	AFDB:G1U2U3	0.917	0.800	1.414E-86	991	0.794	0.690	G1U2U3.pdb.gz	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
3	AFDB:Q9Y210	0.900	0.835	5.510E-85	931	0.742	0.687	Q9Y210.pdb.gz	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
4	PDB:7dxbA	0.821	0.955	1.931E-74	738	0.742	0.867	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
5	PDB:6uz8A	0.809	0.945	5.654E-68	734	0.689	0.809	6uz8A.pdb.gz	Structural basis for pharmacological modulation of the TRPC6 channel.
6	PDB:7dxgA	0.767	0.940	2.104E-67	698	0.673	0.831	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
7	PDB:5zbgA	0.744	0.951	2.723E-58	670	0.677	0.872	5zbgA.pdb.gz
8	PDB:5yx9A	0.732	0.925	5.650E-56	675	0.655	0.837	5yx9A.pdb.gz
9	AFDB:O35119	0.752	0.666	2.320E-47	977	0.375	0.331	O35119.pdb.gz	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
10	AFDB:Q9QX29	0.753	0.668	4.387E-47	975	0.364	0.322	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
11	AFDB:A0A0R4IM91	0.752	0.710	5.797E-47	915	0.367	0.345	A0A0R4IM91.pdb.gz	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
12	AFDB:Q9VJJ7	0.767	0.592	1.632E-46	1128	0.363	0.277	Q9VJJ7.pdb.gz	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
13	AFDB:E1U7G1	0.746	0.805	1.171E-42	796	0.309	0.334	E1U7G1.pdb.gz	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
14	AFDB:Q9R244	0.761	0.569	5.990E-42	1172	0.338	0.248	Q9R244.pdb.gz	TRPC2_MOUSE Short transient receptor potential channel 2 OS=Mus musculus OX=10090 GN=Trpc2 PE=2 SV=2
15	AFDB:P19334	0.755	0.516	1.133E-41	1275	0.321	0.217	P19334.pdb.gz	TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster OX=7227 GN=trp PE=1 SV=3
16	PDB:7b0jA	0.695	0.871	5.144E-40	682	0.346	0.437	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
17	PDB:7b1gA	0.698	0.862	2.985E-38	691	0.358	0.447	7b1gA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
18	PDB:6ysnA	0.616	0.868	5.142E-34	606	0.317	0.450	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
19	PDB:7a6uA	0.302	0.770	2.791E-24	332	0.273	0.708	7a6uA.pdb.gz
20	PDB:5vkqA	0.409	0.249	1.674E-17	1499	0.167	0.096	5vkqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IM91	0.0	557	915	0.372	0.351	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
2	A0A8I6ATX7	0.0	1620	800	0.913	0.984	A0A8I6ATX7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
3	A0A8I6GIE6	0.0	1616	807	0.916	0.979	A0A8I6GIE6_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
4	A0A8I6GIF7	0.0	1576	801	0.897	0.965	A0A8I6GIF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
5	F1LQF7	0.0	1771	862	0.985	0.985	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
6	F7EUD8	0.0	538	406	0.300	0.638	F7EUD8_RAT Transient receptor ion channel domain-containing protein OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
7	G1U2U3	0.0	1409	991	0.798	0.694	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
8	Q13507	0.0	1404	921	0.796	0.745	TRPC3_HUMAN Short transient receptor potential channel 3 OS=Homo sapiens OX=9606 GN=TRPC3 PE=1 SV=4
9	Q61143	0.0	1303	930	0.741	0.687	TRPC6_MOUSE Short transient receptor potential channel 6 OS=Mus musculus OX=10090 GN=Trpc6 PE=1 SV=3
10	Q8VD38	0.0	550	974	0.375	0.332	Q8VD38_RAT Transient receptor potential cation channel subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=2 SV=1
11	Q99N78	0.0	1305	930	0.744	0.689	Q99N78_RAT Transient receptor potential Ca2+ channel 6A OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
12	Q9HCX4	0.0	1796	862	1.000	1.000	TRPC7_HUMAN Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1
13	Q9JMI9	0.0	1391	909	0.789	0.748	TRPC3_RAT Short transient receptor potential channel 3 OS=Rattus norvegicus OX=10116 GN=Trpc3 PE=2 SV=4
14	Q9QX29	0.0	550	975	0.375	0.331	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
15	Q9QZC1	0.0	1391	910	0.784	0.743	TRPC3_MOUSE Short transient receptor potential channel 3 OS=Mus musculus OX=10090 GN=Trpc3 PE=1 SV=2
16	Q9VJJ7	0.0	558	1128	0.365	0.279	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
17	Q9WVC5	0.0	1765	862	0.981	0.981	TRPC7_MOUSE Short transient receptor potential channel 7 OS=Mus musculus OX=10090 GN=Trpc7 PE=2 SV=1
18	Q9Y210	0.0	1319	931	0.747	0.692	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
19	U3N7D8	0.0	555	915	0.372	0.351	U3N7D8_DANRE Transient receptor potential cation channel subfamily c member 4a OS=Danio rerio OX=7955 GN=trpc4a PE=1 SV=1
20	Q9UL62	4.97e-180	546	973	0.375	0.332	TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	46	15.9	Ankyrin repeat
2	PF12796 Ank_2	4.1e-06	38.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.5	19.8	Ankyrin repeat
4	PF13637 Ank_4	3.6	19.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.8	19.6	Ankyrin repeats (many copies)
6	PF00520 Ion_trans	2e-29	114.2	Ion transport protein
7	PF08016 PKD_channel	1.7e-08	45.7	Polycystin cation channel
8	PF08344 TRP_2	2.1e-22	90.4	Transient receptor ion channel II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321106	0.905	Protachykinin-1
2	9606.ENSP00000258149	0.808	E3 ubiquitin-protein ligase Mdm2
3	9606.ENSP00000250101	0.768	Thioredoxin domain-containing protein 17
4	9606.ENSP00000340913	0.756	Short transient receptor potential channel 6
5	9606.ENSP00000245983	0.752	Progonadoliberin-2
6	9606.ENSP00000368966	0.751	Short transient receptor potential channel 3
7	9606.ENSP00000244007	0.723	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
8	9606.ENSP00000483110	0.720	Tachykinin-3
9	9606.ENSP00000256857	0.688	Gastrin-releasing peptide
10	9606.ENSP00000303522	0.687	Substance-P receptor
11	9606.ENSP00000205402	0.661	Dihydrolipoyl dehydrogenase, mitochondrial
12	9606.ENSP00000419313	0.653	Short transient receptor potential channel 1
13	9606.ENSP00000369027	0.639	Short transient receptor potential channel 4
14	9606.ENSP00000262839	0.628	Short transient receptor potential channel 5
15	9606.ENSP00000276414	0.615	Progonadoliberin-1
16	9606.ENSP00000356150	0.604	Protein Mdm4
17	9606.ENSP00000381237	0.584	Histocompatibility minor 13
18	9606.ENSP00000362403	0.571	Substance-K receptor
19	9606.ENSP00000236147	0.565	L-selectin
20	9606.ENSP00000378089	0.560	Neuromedin-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005261	1.000	monoatomic cation channel activity
GO:0005262	0.981	calcium channel activity
GO:0043167	0.466	ion binding
GO:0042802	0.426	identical protein binding
GO:0015279	0.329	store-operated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.968	biological regulation
GO:0006816	0.953	calcium ion transport
GO:0055085	0.934	transmembrane transport
GO:0098655	0.908	monoatomic cation transmembrane transport
GO:0050789	0.895	regulation of biological process
GO:0050896	0.890	response to stimulus
GO:0070588	0.890	calcium ion transmembrane transport
GO:0050794	0.839	regulation of cellular process
GO:0051716	0.724	cellular response to stimulus
GO:0023052	0.526	signaling
GO:0007154	0.509	cell communication
GO:0048518	0.508	positive regulation of biological process
GO:0007165	0.454	signal transduction
GO:0048522	0.375	positive regulation of cellular process
GO:0065008	0.343	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043226	0.995	organelle
GO:0005622	0.995	intracellular anatomical structure
GO:0043227	0.989	membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0005886	0.981	plasma membrane
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0012505	0.958	endomembrane system
GO:0005801	0.769	cis-Golgi network
GO:0048471	0.705	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.981	Ca(2+)(in) = Ca(2+)(out)

[back to server]