StarFunc result for job id Q9HCY8

User Input

>input (104 residues)
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPS
NCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCY8	1.000	1.000	7.047E-17	104	1.000	1.000	Q9HCY8.pdb.gz	S10AE_HUMAN Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1
2	PDB:2m0rA	0.702	0.702	3.631E-12	104	1.000	1.000	2m0rA.pdb.gz
3	AFDB:P79342	0.711	0.750	1.497E-4	98	0.337	0.357	P79342.pdb.gz	S10AD_BOVIN Protein S100-A13 OS=Bos taurus OX=9913 GN=S100A13 PE=3 SV=2
4	AFDB:Q91061	0.592	0.658	1.997E-4	92	0.240	0.272	Q91061.pdb.gz	S10I_ICTPU Ictacalcin OS=Ictalurus punctatus OX=7998 PE=2 SV=1
5	AFDB:P27005	0.622	0.710	4.735E-4	89	0.183	0.213	P27005.pdb.gz	S10A8_MOUSE Protein S100-A8 OS=Mus musculus OX=10090 GN=S100a8 PE=1 SV=3
6	AFDB:P50115	0.629	0.721	4.735E-4	89	0.183	0.213	P50115.pdb.gz	S10A8_RAT Protein S100-A8 OS=Rattus norvegicus OX=10116 GN=S100a8 PE=1 SV=3
7	AFDB:A0A0S2Z4C5	0.602	0.670	6.689E-4	92	0.231	0.261	A0A0S2Z4C5.pdb.gz	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
8	PDB:2kotA	0.613	0.643	7.269E-4	98	0.327	0.347	2kotA.pdb.gz	Molecular level interactions of S100A13 with amlexanox: inhibitor for the formation of multi-protein complex in non-classical pathway of the acidic fibroblast growth factor
9	AFDB:P08207	0.614	0.653	7.506E-4	97	0.221	0.237	P08207.pdb.gz	S10AA_MOUSE Protein S100-A10 OS=Mus musculus OX=10090 GN=S100a10 PE=1 SV=2
10	AFDB:P05109	0.587	0.646	8.421E-4	93	0.183	0.204	P05109.pdb.gz	S10A8_HUMAN Protein S100-A8 OS=Homo sapiens OX=9606 GN=S100A8 PE=1 SV=1
11	PDB:5csnA	0.616	0.673	9.694E-4	94	0.240	0.266	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
12	AFDB:P80511	0.631	0.702	1.001E-3	92	0.231	0.261	P80511.pdb.gz	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
13	AFDB:P50543	0.598	0.628	1.123E-3	98	0.240	0.255	P50543.pdb.gz	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
14	PDB:2wc8D	0.591	0.649	1.220E-3	93	0.231	0.258	2wc8D.pdb.gz	The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
15	PDB:7psqG	0.609	0.589	1.369E-3	108	0.231	0.222	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
16	PDB:6zdyA	0.706	0.683	1.451E-3	108	0.279	0.269	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
17	PDB:2k2fA	0.631	0.697	2.733E-3	93	0.231	0.258	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
18	PDB:2rgiA	0.582	0.642	2.895E-3	93	0.202	0.226	2rgiA.pdb.gz
19	PDB:1k96A	0.597	0.684	3.066E-3	89	0.192	0.225	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
20	PDB:4hrgA	0.572	0.529	3.248E-3	114	0.231	0.211	4hrgA.pdb.gz	SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCY8	1.26e-74	217	104	1.000	1.000	S10AE_HUMAN Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1
2	P79342	1.98e-18	75.5	98	0.356	0.378	S10AD_BOVIN Protein S100-A13 OS=Bos taurus OX=9913 GN=S100A13 PE=3 SV=2
3	Q99584	3.65e-18	74.7	98	0.337	0.357	S10AD_HUMAN Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1
4	P97352	1.14e-17	73.6	98	0.356	0.378	S10AD_MOUSE Protein S100-A13 OS=Mus musculus OX=10090 GN=S100a13 PE=1 SV=1
5	A0A060YVE5	1.34e-07	47.4	95	0.240	0.263	A0A060YVE5_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00045272001 PE=4 SV=1
6	A0A060YDS7	1.54e-07	47.4	95	0.240	0.263	A0A060YDS7_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040819001 PE=4 SV=1
7	P60903	3.87e-07	46.2	97	0.231	0.247	S10AA_HUMAN Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2
8	P08207	9.11e-07	45.4	97	0.221	0.237	S10AA_MOUSE Protein S100-A10 OS=Mus musculus OX=10090 GN=S100a10 PE=1 SV=2
9	Q96FQ6	1.07e-06	45.4	103	0.212	0.214	S10AG_HUMAN Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1
10	P80310	1.36e-06	45.1	92	0.260	0.293	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
11	P26447	1.72e-06	44.7	101	0.212	0.218	S10A4_HUMAN Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1
12	P05943	2.63e-06	44.3	95	0.221	0.242	S10AA_RAT Protein S100-A10 OS=Rattus norvegicus OX=10116 GN=S100a10 PE=1 SV=2
13	Q91061	3.75e-06	43.9	92	0.250	0.283	S10I_ICTPU Ictacalcin OS=Ictalurus punctatus OX=7998 PE=2 SV=1
14	W5UM31	4.41e-06	43.5	92	0.250	0.283	W5UM31_ICTPU Protein S100 OS=Ictalurus punctatus OX=7998 GN=S10I PE=2 SV=1
15	Q9PSF6	4.90e-06	43.5	92	0.250	0.283	Q9PSF6_ICTPU Protein S100 OS=Ictalurus punctatus OX=7998 PE=3 SV=1
16	P02638	6.82e-06	43.1	92	0.240	0.272	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2
17	P06702	7.31e-06	43.5	114	0.260	0.237	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
18	P80511	7.67e-06	42.7	92	0.231	0.261	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
19	P07091	1.03e-05	42.7	101	0.202	0.208	S10A4_MOUSE Protein S100-A4 OS=Mus musculus OX=10090 GN=S100a4 PE=1 SV=1
20	P50116	1.31e-05	42.7	113	0.298	0.274	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01023 S_100	6.3e-11	53.0	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357693	0.966	Protein S100-A16
2	9606.ENSP00000385923	0.812	Nucleobindin-1
3	9606.ENSP00000357702	0.739	Protein S100-A3
4	9606.ENSP00000308597	0.720	Deleted in lung and esophageal cancer protein 1
5	9606.ENSP00000371000	0.720	E3 ubiquitin-protein ligase RNF6
6	9606.ENSP00000354376	0.673	Ras-related protein Rab-25
7	9606.ENSP00000357707	0.655	Protein S100-A5
8	9606.ENSP00000357697	0.652	Protein S100-A2
9	9606.ENSP00000370981	0.647	Leucine zipper putative tumor suppressor 1
10	9606.ENSP00000331678	0.634	Plakophilin-3
11	9606.ENSP00000473929	0.589	FXYD domain-containing ion transport regulator 3
12	9606.ENSP00000357709	0.571	Protein S100-A6
13	9606.ENSP00000357705	0.545	S100 calcium binding protein A4
14	9606.ENSP00000375829	0.538	Ladinin-1
15	9606.ENSP00000306606	0.537	Alcohol dehydrogenase 1B, beta polypeptide
16	9606.ENSP00000357712	0.526	S100 calcium binding protein A7
17	9606.ENSP00000292169	0.524	Protein S100-A1
18	9606.ENSP00000391490	0.507	Anterior gradient protein 2 homolog
19	9606.ENSP00000269571	0.504	Receptor tyrosine-protein kinase erbB-2
20	9606.ENSP00000357801	0.500	Protein S100-A10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042379	0.995	chemokine receptor binding
GO:0043167	0.858	ion binding
GO:0042802	0.836	identical protein binding
GO:0046872	0.571	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0048522	0.986	positive regulation of cellular process
GO:0048583	0.968	regulation of response to stimulus
GO:0051716	0.958	cellular response to stimulus
GO:0048584	0.934	positive regulation of response to stimulus
GO:0030334	0.919	regulation of cell migration
GO:0007154	0.906	cell communication
GO:0023052	0.905	signaling
GO:0007165	0.879	signal transduction
GO:0030335	0.871	positive regulation of cell migration
GO:0002376	0.850	immune system process
GO:0032101	0.848	regulation of response to external stimulus
GO:0002687	0.836	positive regulation of leukocyte migration
GO:0071677	0.827	positive regulation of mononuclear cell migration
GO:0009605	0.814	response to external stimulus
GO:0080134	0.811	regulation of response to stress
GO:0032103	0.788	positive regulation of response to external stimulus
GO:0031349	0.786	positive regulation of defense response
GO:0050921	0.779	positive regulation of chemotaxis
GO:0071622	0.779	regulation of granulocyte chemotaxis
GO:0042221	0.769	response to chemical
GO:0002758	0.752	innate immune response-activating signaling pathway
GO:0006950	0.750	response to stress
GO:0009617	0.693	response to bacterium
GO:0010033	0.625	response to organic substance
GO:0002690	0.625	positive regulation of leukocyte chemotaxis
GO:0006952	0.624	defense response
GO:0002221	0.599	pattern recognition receptor signaling pathway
GO:0007166	0.575	cell surface receptor signaling pathway
GO:0002237	0.573	response to molecule of bacterial origin
GO:0002768	0.561	immune response-regulating cell surface receptor signaling pathway
GO:0002429	0.528	immune response-activating cell surface receptor signaling pathway
GO:0002220	0.513	innate immune response activating cell surface receptor signaling pathway
GO:0032496	0.315	response to lipopolysaccharide
GO:0019222	0.302	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005576	0.999	extracellular region
GO:0005615	0.984	extracellular space
GO:0031982	0.979	vesicle
GO:0070062	0.955	extracellular exosome
GO:0043229	0.951	intracellular organelle
GO:0071944	0.929	cell periphery
GO:0043231	0.926	intracellular membrane-bounded organelle
GO:0016020	0.840	membrane
GO:0048471	0.696	perinuclear region of cytoplasm
GO:0005634	0.510	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]