StarFunc result for job id Q9HCZ1

User Input

>input (680 residues)
MKMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGYHVSKPDVIF
KLEQGEEPWIVEEFSNQNYPDIDDALEKNKEIQDKHLTQTVFFSNKTLITERENVFGKTL
NLGMNSVPSRKMPYKCNPGGNSLKTNSEVIVAKKSKENRKIPDGYSGFGKHEKSHLGMKK
YRYNPMRKASNQNENLILHQNIQILKQPFDYNKCGKTFFKRAILITQKGRQTERKPNECN
ECRKTFSKRSTLIVHQRIHTGEKPYVCSDCRKTFRVKTSLTRHRRIHTGERPYECSECRK
TFIDKSALIVHQKIHGGEKSYECNECGKTFFRKSALAEHFRSHTGEKPYECKECGNAFSK
KSYLVVHQRTHRGEKPNECKECGKTFFCQSALTAHQRIHTGEKPYECSECEKTFFCQSAL
NVHRRSHTGEKPYECSQCGKFLCTKSALIAHQITHRGKKSYECNECGKFFCHKSTLTIHQ
RTHTGEKHGVFNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHLIVHQRTIW
ERPYECNECGRTYCRKSALTHHQRTHTGQRPYECNECGKTFCQKFSFVEHQRTHTGEKPY
ECNECGKSFCHKSAFRVHRRIHTGEKPYECNQCGKTYRRLWTLTEHQKIHTGEKPYECNK
CEKTFRHKSNFLLHQKSHKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCZ1	1.000	1.000	0.000	680	1.000	1.000	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
2	AFDB:Q06732	0.336	0.297	2.631E-62	778	0.543	0.474	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:P17014	0.332	0.325	1.297E-60	697	0.522	0.509	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
4	AFDB:Q14587	0.318	0.238	7.892E-59	947	0.475	0.341	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
5	AFDB:Q9NYW8	0.352	0.337	1.650E-58	714	0.491	0.468	Q9NYW8.pdb.gz	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
6	AFDB:P51523	0.320	0.296	2.421E-57	738	0.491	0.453	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
7	AFDB:Q9P2J8	0.319	0.258	1.700E-56	865	0.441	0.347	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
8	AFDB:Q6ECI4	0.322	0.307	2.879E-56	717	0.416	0.395	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
9	AFDB:Q5TYW1	0.328	0.218	3.372E-56	1059	0.522	0.335	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
10	AFDB:Q9BX82	0.335	0.360	1.473E-55	626	0.409	0.444	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
11	PDB:3w5kB	0.077	0.251	5.730E-4	110	0.056	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7lbmd	0.053	0.098	8.220E-1	275	0.044	0.109	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
13	PDB:4kblA	0.057	0.076	1.070	395	0.066	0.114	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
14	PDB:5dkaA	0.048	0.218	1.630	96	0.028	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7nvr3	0.056	0.128	2.013	214	0.041	0.131	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
16	PDB:7fikP	0.075	0.083	2.236	593	0.029	0.034	7fikP.pdb.gz
17	PDB:7ad8D	0.037	0.067	2.357	280	0.028	0.068	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
18	PDB:4oo8D	0.065	0.045	2.619	1163	0.063	0.037	4oo8D.pdb.gz	Crystal structure of Cas9 in complex with guide RNA and target DNA
19	PDB:7c4cA	0.059	0.099	2.910	332	0.035	0.072	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
20	PDB:4yrvA	0.050	0.096	3.067	288	0.043	0.101	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17014	0.0	632	697	0.526	0.514	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
2	P51523	0.0	617	738	0.493	0.454	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
3	P51814	0.0	564	821	0.472	0.391	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
4	P52742	0.0	541	658	0.453	0.468	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
5	Q06732	0.0	643	778	0.537	0.469	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
6	Q14587	0.0	582	947	0.487	0.350	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	Q5MCW4	0.0	587	686	0.471	0.466	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
8	Q6ECI4	0.0	536	717	0.451	0.428	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
9	Q8N184	0.0	571	647	0.469	0.493	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
10	Q8TAQ5	0.0	565	688	0.457	0.452	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	Q9HCZ1	0.0	1402	680	1.000	1.000	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
12	Q9NYW8	0.0	599	714	0.493	0.469	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
13	Q9P2J8	0.0	552	865	0.468	0.368	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
14	O94892	2.81e-179	526	652	0.443	0.462	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
15	Q8NDQ6	2.39e-175	517	660	0.435	0.448	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
16	Q5TYW1	6.56e-174	526	1059	0.413	0.265	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
17	Q9BX82	1.07e-170	504	626	0.416	0.452	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
18	Q7TMN8	4.35e-169	498	578	0.388	0.457	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
19	Q8BLA2	2.01e-168	496	578	0.387	0.455	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
20	Q7Z3V5	2.70e-168	497	609	0.428	0.478	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	94	14.7	TFIIH C1-like domain
2	PF01352 KRAB	1.3e-21	87.2	KRAB box
3	PF12812 PDZ_1	2.2e+02	13.3	PDZ-like domain
4	PF00096 zf-C2H2	3.3e-59	205.3	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	9.9e-31	114.8	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1e-05	36.7	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	70	15.1	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	4.1e-92	310.1	Zinc-finger double domain
9	PF12874 zf-met	2.4e+02	13.5	Zinc-finger of C2H2 type
10	PF09723 Zn-ribbon_8	30	16.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300213	0.634	Cyclin-D1-binding protein 1
2	9606.ENSP00000290246	0.596	Engulfment and cell motility protein 2
3	9606.ENSP00000392660	0.556	Rho GTPase-activating protein 28
4	9606.ENSP00000382976	0.540	Lethal(3)malignant brain tumor-like protein 4
5	9606.ENSP00000290231	0.528	Nuclear receptor coactivator 5
6	9606.ENSP00000252505	0.523	Probable allantoicase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.387	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0009889	0.980	regulation of biosynthetic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0019219	0.947	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0006355	0.928	regulation of DNA-templated transcription
GO:1902679	0.693	negative regulation of RNA biosynthetic process
GO:1903507	0.668	negative regulation of nucleic acid-templated transcription
GO:0009987	0.598	cellular process
GO:0045892	0.526	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.990	nucleoplasm
GO:0005737	0.644	cytoplasm
GO:0005829	0.343	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]