StarFunc result for job id Q9HD15

User Input

>input (236 residues)
MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGS
PRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQ
ALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIH
RSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HD15	1.000	1.000	2.215E-31	236	1.000	1.000	Q9HD15.pdb.gz	SRA1_HUMAN Steroid receptor RNA activator 1 OS=Homo sapiens OX=9606 GN=SRA1 PE=1 SV=2
2	AFDB:Q80VJ2	0.586	0.596	6.717E-25	232	0.809	0.823	Q80VJ2.pdb.gz	SRA1_MOUSE Steroid receptor RNA activator 1 OS=Mus musculus OX=10090 GN=Sra1 PE=1 SV=4
3	AFDB:F1QPE4	0.451	0.504	2.575E-15	211	0.424	0.474	F1QPE4.pdb.gz
4	AFDB:D6REX3	0.395	0.078	3.156E-4	1251	0.195	0.037	D6REX3.pdb.gz	D6REX3_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
5	AFDB:A0A0B4LEZ1	0.403	0.078	5.377E-4	1260	0.182	0.034	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
6	AFDB:H7BXG7	0.395	0.101	5.672E-4	969	0.191	0.046	H7BXG7.pdb.gz	H7BXG7_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
7	AFDB:Q7SYD5	0.399	0.078	5.672E-4	1254	0.220	0.041	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
8	AFDB:P38968	0.403	0.079	7.019E-4	1273	0.195	0.036	P38968.pdb.gz	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
9	AFDB:Q09762	0.372	0.394	1.262E-3	220	0.178	0.191	Q09762.pdb.gz	YA78_SCHPO Uncharacterized protein C24H6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC24H6.08 PE=4 SV=1
10	AFDB:A0A024RDH6	0.396	0.083	1.737E-3	1181	0.161	0.032	A0A024RDH6.pdb.gz
11	PDB:5wsgf	0.364	0.548	2.842E-2	148	0.081	0.128	5wsgf.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
12	PDB:5iztA	0.142	0.154	3.129E-1	211	0.030	0.033	5iztA.pdb.gz
13	PDB:6exna	0.349	0.467	6.960E-1	171	0.076	0.105	6exna.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
14	PDB:4jrzA	0.157	0.222	9.086E-1	155	0.068	0.103	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
15	PDB:4zuyA	0.159	0.331	9.086E-1	96	0.064	0.156	4zuyA.pdb.gz
16	PDB:4kblA	0.163	0.107	1.125	395	0.064	0.038	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
17	PDB:2jmhA	0.147	0.239	1.251	117	0.059	0.120	2jmhA.pdb.gz
18	PDB:7p3xS	0.153	0.196	1.251	168	0.059	0.083	7p3xS.pdb.gz
19	PDB:5xezB	0.189	0.101	1.320	499	0.102	0.048	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
20	PDB:2gs4A	0.180	0.237	1.548	159	0.093	0.138	2gs4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HD15	6.10e-165	456	224	0.949	1.000	SRA1_HUMAN Steroid receptor RNA activator 1 OS=Homo sapiens OX=9606 GN=SRA1 PE=1 SV=2
2	Q80VJ2	5.87e-117	334	220	0.780	0.836	SRA1_MOUSE Steroid receptor RNA activator 1 OS=Mus musculus OX=10090 GN=Sra1 PE=1 SV=4
3	Q6QGW5	3.79e-114	327	219	0.763	0.822	SRA1_RAT Steroid receptor RNA activator 1 OS=Rattus norvegicus OX=10116 GN=Sra1 PE=1 SV=2
4	Q6IQU0	1.45e-62	196	211	0.462	0.517	Q6IQU0_DANRE Steroid receptor RNA activator 1 OS=Danio rerio OX=7955 GN=zgc:86613 PE=1 SV=1
5	O13637	7.74e-09	57.8	1224	0.169	0.033	SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec31 PE=1 SV=1
6	Q8L611	0.005	40.0	1104	0.106	0.023	SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC31B PE=1 SV=1
7	Q9NTJ3	0.013	38.9	1288	0.131	0.024	SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2
8	Q8K1S6	0.055	37.0	718	0.106	0.035	SPIR2_MOUSE Protein spire homolog 2 OS=Mus musculus OX=10090 GN=Spire2 PE=1 SV=1
9	P38968	0.056	37.0	1273	0.191	0.035	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
10	Q8IZP9	0.11	36.2	1017	0.114	0.027	AGRG2_HUMAN Adhesion G-protein coupled receptor G2 OS=Homo sapiens OX=9606 GN=ADGRG2 PE=1 SV=2
11	Q9W4M4	0.23	35.0	1357	0.076	0.013	Q9W4M4_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15570 PE=1 SV=1
12	P34109	0.42	34.3	1109	0.119	0.025	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
13	Q8CG73	1.0	33.1	1264	0.081	0.015	FTM_MOUSE Protein fantom OS=Mus musculus OX=10090 GN=Rpgrip1l PE=1 SV=2
14	Q51912	1.3	32.7	719	0.089	0.029	Q51912_FINMA Gram-positive cocci surface proteins LPxTG domain-containing protein OS=Finegoldia magna OX=1260 PE=1 SV=1
15	Q9SS47	2.5	32.0	1003	0.089	0.021	PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana OX=3702 GN=APUM4 PE=1 SV=2
16	Q7SYD5	4.2	31.2	1254	0.203	0.038	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
17	Q9W3H5	6.5	29.6	165	0.085	0.121	Q9W3H5_DROME GEO04367p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2147 PE=1 SV=1
18	Q8R5H6	9.4	30.0	559	0.136	0.057	WASF1_MOUSE Actin-binding protein WASF1 OS=Mus musculus OX=10090 GN=Wasf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07304 SRA1	6e-70	245.2	Steroid receptor RNA activator (SRA1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.965	Estrogen receptor
2	9606.ENSP00000380033	0.964	Probable ATP-dependent RNA helicase DDX17
3	9606.ENSP00000385216	0.955	Nuclear receptor coactivator 1
4	9606.ENSP00000365312	0.940	Abl interactor 1
5	9606.ENSP00000295851	0.937	Abl interactor 2
6	9606.ENSP00000483313	0.937	Wiskott-Aldrich syndrome protein family member 2
7	9606.ENSP00000236850	0.917	Apolipoprotein A-I
8	9606.ENSP00000383063	0.911	Nuclear receptor-interacting protein 1
9	9606.ENSP00000477707	0.910	Oxysterols receptor LXR-alpha
10	9606.ENSP00000263253	0.908	Histone acetyltransferase p300
11	9606.ENSP00000309757	0.905	Lipoprotein lipase
12	9606.ENSP00000385523	0.905	Peroxisome proliferator-activated receptor alpha
13	9606.ENSP00000300651	0.904	Mediator of RNA polymerase II transcription subunit 1
14	9606.ENSP00000399968	0.903	Nuclear receptor coactivator 2
15	9606.ENSP00000432472	0.902	Protein BRICK1
16	9606.ENSP00000231887	0.900	Peroxisomal bifunctional enzyme
17	9606.ENSP00000262367	0.900	CREB-binding protein
18	9606.ENSP00000264867	0.900	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
19	9606.ENSP00000265641	0.900	Carnitine O-palmitoyltransferase 1, liver isoform
20	9606.ENSP00000293217	0.900	Peroxisomal acyl-coenzyme A oxidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003727	0.996	single-stranded RNA binding
GO:0003677	0.590	DNA binding
GO:0002153	0.543	steroid receptor RNA activator RNA binding
GO:0030374	0.341	nuclear receptor coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.981	response to stimulus
GO:0009987	0.969	cellular process
GO:0048518	0.941	positive regulation of biological process
GO:0010033	0.932	response to organic substance
GO:0051716	0.914	cellular response to stimulus
GO:0048519	0.909	negative regulation of biological process
GO:0048523	0.903	negative regulation of cellular process
GO:0048522	0.887	positive regulation of cellular process
GO:0019222	0.886	regulation of metabolic process
GO:0080090	0.878	regulation of primary metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0071310	0.843	cellular response to organic substance
GO:0051171	0.831	regulation of nitrogen compound metabolic process
GO:0031323	0.827	regulation of cellular metabolic process
GO:0010468	0.821	regulation of gene expression
GO:0009719	0.757	response to endogenous stimulus
GO:0045595	0.744	regulation of cell differentiation
GO:0009725	0.727	response to hormone
GO:0009893	0.678	positive regulation of metabolic process
GO:0019219	0.658	regulation of nucleobase-containing compound metabolic process
GO:0043627	0.657	response to estrogen
GO:0009889	0.566	regulation of biosynthetic process
GO:0051252	0.562	regulation of RNA metabolic process
GO:0010556	0.561	regulation of macromolecule biosynthetic process
GO:0031326	0.560	regulation of cellular biosynthetic process
GO:0010604	0.552	positive regulation of macromolecule metabolic process
GO:0045661	0.534	regulation of myoblast differentiation
GO:0031325	0.530	positive regulation of cellular metabolic process
GO:2001141	0.529	regulation of RNA biosynthetic process
GO:0051173	0.514	positive regulation of nitrogen compound metabolic process
GO:0006355	0.508	regulation of DNA-templated transcription
GO:0010557	0.501	positive regulation of macromolecule biosynthetic process
GO:0032502	0.493	developmental process
GO:0045935	0.493	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.464	positive regulation of RNA metabolic process
GO:0006357	0.453	regulation of transcription by RNA polymerase II
GO:0031328	0.448	positive regulation of cellular biosynthetic process
GO:0045893	0.399	positive regulation of DNA-templated transcription
GO:0045944	0.381	positive regulation of transcription by RNA polymerase II
GO:0010941	0.371	regulation of cell death
GO:0032870	0.323	cellular response to hormone stimulus
GO:0032501	0.317	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.993	cytosol
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0016020	0.987	membrane
GO:0005886	0.940	plasma membrane
GO:0005856	0.710	cytoskeleton
GO:1990904	0.698	ribonucleoprotein complex
GO:0031209	0.653	SCAR complex
GO:0015630	0.470	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]