StarFunc result for job id Q9HD20

User Input

>input (1204 residues)
MAAAAAVGNAVPCGARPCGVRPDGQPKPGPQPRALLAAGPALIANGDELVAAVWPYRRLA
LLRRLTVLPFAGLLYPAWLGAAAAGCWGWGSSWVQIPEAALLVLATICLAHALTVLSGHW
SVHAHCALTCTPEYDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYS
YDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNKAEMVVPDFSELFKE
RATAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKPHM
IQVYRSRKWRPIASDEIVPGDIVSIGRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQM
KEPIEDLSPDRVLDLQADSRLHVIFGGTKVVQHIPPQKATTGLKPVDSGCVAYVLRTGFN
TSQGKLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWIEGTKDPSRNRYKLFLE
CTLILTSVVPPELPIELSLAVNTSLIALAKLYMYCTEPFRIPFAGKVEVCCFDKTGTLTS
DSLVVRGVAGLRDGKEVTPVSSIPVETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDW
TLTKDEKVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETL
HSMFSQCPPDYHHIHTEISREGARVLALGYKELGHLTHQQAREVKREALECSLKFVGFIV
VSCPLKADSKAVIREIQNASHRVVMITGDNPLTACHVAQELHFIEKAHTLILQPPSEKGR
QCEWRSIDGSIVLPLARGSPKALALEYALCLTGDGLAHLQATDPQQLLRLIPHVQVFARV
APKQKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLANAPERVVERRRRPRDSP
TLSNSGIRATSRTAKQRSGLPPSEEQPTSQRDRLSQVLRDLEDESTPIVKLGDASIAAPF
TSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQ
GLLLAGCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFFVHFLSLVYLYREAQARS
PEKQEQFVDLYKEFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPLVWSLAV
SLLAIIGLLLGSSPDFNSQFGLVDIPVEFKLVIAQVLLLDFCLALLADRVLQFFLGTPKL
KVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P90747	0.891	0.911	0.000	1178	0.517	0.529	P90747.pdb.gz	AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans OX=6239 GN=catp-8 PE=3 SV=3
2	AFDB:Q9HD20	1.000	1.000	0.000	1204	1.000	1.000	Q9HD20.pdb.gz	AT131_HUMAN Endoplasmic reticulum transmembrane helix translocase OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2
3	AFDB:Q9LT02	0.885	0.903	0.000	1179	0.424	0.433	Q9LT02.pdb.gz	PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana OX=3702 GN=PDR2 PE=1 SV=1
4	AFDB:Q9VKJ6	0.903	0.888	0.000	1225	0.522	0.513	Q9VKJ6.pdb.gz	Q9VKJ6_DROME FI03653p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6230 PE=1 SV=1
5	AFDB:O14072	0.872	0.867	8.902E-99	1211	0.396	0.394	O14072.pdb.gz	ATC4_SCHPO Endoplasmic reticulum transmembrane helix translocase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cta4 PE=1 SV=1
6	AFDB:Q59Q34	0.873	0.860	1.150E-97	1223	0.400	0.393	Q59Q34.pdb.gz	Q59Q34_CANAL Ion-transporting P-type ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPF1 PE=3 SV=1
7	AFDB:P39986	0.869	0.862	1.550E-96	1215	0.389	0.385	P39986.pdb.gz	SPF1_YEAST Endoplasmic reticulum transmembrane helix translocase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPF1 PE=1 SV=1
8	AFDB:Q57YG5	0.819	0.783	3.075E-87	1261	0.351	0.335	Q57YG5.pdb.gz	Q57YG5_TRYB2 Cation-transporting ATPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.210 PE=4 SV=1
9	PDB:6xmtA	0.699	0.760	1.929E-83	1092	0.381	0.420	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.
10	AFDB:Q9H7F0	0.779	0.766	1.700E-68	1226	0.244	0.240	Q9H7F0.pdb.gz	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
11	AFDB:H2L3J0	0.749	0.787	6.380E-67	1143	0.251	0.264	H2L3J0.pdb.gz	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
12	PDB:7vpkA	0.646	0.727	4.183E-58	1055	0.242	0.276	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
13	PDB:7m5xA	0.636	0.751	7.934E-56	1000	0.231	0.278	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
14	PDB:7e7sA	0.493	0.570	7.976E-35	1020	0.159	0.188	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:5zmwA	0.479	0.562	7.326E-34	1000	0.154	0.185	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
16	PDB:7x20A	0.498	0.589	3.123E-33	986	0.141	0.172	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
17	PDB:7rd6A	0.530	0.663	1.795E-31	929	0.144	0.186	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
18	PDB:6rohA	0.525	0.563	2.319E-30	1112	0.142	0.154	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
19	PDB:3ixzA	0.473	0.551	2.750E-30	998	0.156	0.188	3ixzA.pdb.gz
20	PDB:8d3xA	0.486	0.570	4.996E-30	989	0.150	0.183	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14072	0.0	868	1211	0.404	0.402	ATC4_SCHPO Endoplasmic reticulum transmembrane helix translocase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cta4 PE=1 SV=1
2	P39986	0.0	840	1215	0.388	0.384	SPF1_YEAST Endoplasmic reticulum transmembrane helix translocase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPF1 PE=1 SV=1
3	P90747	0.0	1157	1178	0.520	0.531	AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans OX=6239 GN=catp-8 PE=3 SV=3
4	Q57YG5	0.0	663	1261	0.358	0.342	Q57YG5_TRYB2 Cation-transporting ATPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.210 PE=4 SV=1
5	Q59Q34	0.0	852	1223	0.412	0.406	Q59Q34_CANAL Ion-transporting P-type ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPF1 PE=3 SV=1
6	Q8MSI5	0.0	1137	993	0.468	0.568	Q8MSI5_DROME GH13756p OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH06032 PE=2 SV=1
7	Q9EPE9	0.0	2279	1200	0.949	0.952	AT131_MOUSE Endoplasmic reticulum transmembrane helix translocase OS=Mus musculus OX=10090 GN=Atp13a1 PE=1 SV=2
8	Q9HD20	0.0	2477	1204	1.000	1.000	AT131_HUMAN Endoplasmic reticulum transmembrane helix translocase OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2
9	Q9LT02	0.0	923	1179	0.429	0.438	PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana OX=3702 GN=PDR2 PE=1 SV=1
10	Q9VKJ6	0.0	1226	1225	0.509	0.500	Q9VKJ6_DROME FI03653p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6230 PE=1 SV=1
11	Q9Y139	0.0	1225	1225	0.508	0.500	Q9Y139_DROME BcDNA.GH06032 OS=Drosophila melanogaster OX=7227 GN=BcDNA.GH06032 PE=2 SV=1
12	O74431	1.34e-91	324	1315	0.184	0.169	ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.11c PE=3 SV=1
13	Q12697	1.26e-90	323	1472	0.203	0.166	YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPK9 PE=1 SV=1
14	Q9H7F0	2.34e-81	293	1226	0.181	0.178	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
15	Q21286	3.44e-81	292	1203	0.207	0.207	CATP5_CAEEL Cation-transporting ATPase catp-5 OS=Caenorhabditis elegans OX=6239 GN=catp-5 PE=2 SV=4
16	H2L3J0	8.72e-81	290	1143	0.207	0.218	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
17	Q54X63	7.65e-80	288	1158	0.195	0.203	Q54X63_DICDI Cation-transporting ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279183 PE=3 SV=1
18	A1A5E5	4.94e-77	280	1170	0.192	0.197	A1A5E5_DANRE Cation-transporting ATPase OS=Danio rerio OX=7955 GN=zgc:136762 PE=1 SV=1
19	F5GUA7	1.21e-76	279	1207	0.194	0.193	F5GUA7_CAEEL Cation-transporting P-type ATPase N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
20	Q27533	2.67e-76	278	1256	0.194	0.186	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	0.16	23.4	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	1.1e-19	82.2	E1-E2 ATPase
3	PF00702 Hydrolase	5.6e-13	61.2	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	11	17.2	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349877

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391747	0.705	Laccase domain-containing protein 1
2	9606.ENSP00000364742	0.674	F-box only protein 42
3	9606.ENSP00000287394	0.659	ATPase family AAA domain-containing protein 2
4	9606.ENSP00000384863	0.647	Exportin-1
5	9606.ENSP00000260746	0.646	ADP-ribosylation factor-like protein 3
6	9606.ENSP00000389843	0.609	Sodium-coupled neutral amino acid transporter 4
7	9606.ENSP00000262215	0.604	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
8	9606.ENSP00000332756	0.600	Phospholipid-transporting ATPase IG
9	9606.ENSP00000274311	0.590	Protein pelota homolog
10	9606.ENSP00000445359	0.589	Phospholipid-transporting ATPase IC
11	9606.ENSP00000373696	0.582	E3 ubiquitin-protein ligase TRIP12
12	9606.ENSP00000298910	0.563	Leucine-rich repeat serine/threonine-protein kinase 2
13	9606.ENSP00000484903	0.557	Mitochondrial ribosomal protein L45
14	9606.ENSP00000203556	0.554	GEM-interacting protein
15	9606.ENSP00000460348	0.539	Pre-mRNA-processing-splicing factor 8
16	9606.ENSP00000302851	0.537	Solute carrier family 23 member 1
17	9606.ENSP00000468049	0.536	Zinc finger protein 101
18	9606.ENSP00000302790	0.525	Exportin-6
19	9606.ENSP00000248929	0.517	Small G protein signaling modulator 3
20	9606.ENSP00000421326	0.516	Calcium-transporting ATPase type 2C member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046873	0.999	metal ion transmembrane transporter activity
GO:0019829	0.999	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0005515	0.998	protein binding
GO:0140358	0.987	P-type transmembrane transporter activity
GO:0015662	0.978	P-type ion transporter activity
GO:0140318	0.899	protein transporter activity
GO:0140359	0.889	ABC-type transporter activity
GO:0005384	0.880	manganese ion transmembrane transporter activity
GO:1901702	0.796	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006811	0.986	monoatomic ion transport
GO:0051641	0.966	cellular localization
GO:0055085	0.887	transmembrane transport
GO:0034220	0.805	monoatomic ion transmembrane transport
GO:0033036	0.720	macromolecule localization
GO:0008104	0.657	protein localization
GO:0051668	0.562	localization within membrane
GO:0072657	0.485	protein localization to membrane
GO:0065007	0.484	biological regulation
GO:0050789	0.346	regulation of biological process
GO:0071840	0.334	cellular component organization or biogenesis
GO:0045184	0.334	establishment of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	1.000	organelle membrane
GO:0031984	0.999	organelle subcompartment
GO:0005783	0.998	endoplasmic reticulum
GO:0005789	0.986	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
RHEA:28699	0.880	Mn(2+)(in) = Mn(2+)(out)

[back to server]