StarFunc result for job id Q9HD23

User Input

>input (443 residues)
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRL
RVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRF
QHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTY
PLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKS
LSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYY
RLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGVAFG
MNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADR
SMELKNSLRLDGLGSGRSILTNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HD23	1.000	1.000	1.679E-64	443	1.000	1.000	Q9HD23.pdb.gz	MRS2_HUMAN Magnesium transporter MRS2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=MRS2 PE=1 SV=1
2	AFDB:Q5NCE8	0.821	0.837	3.565E-53	434	0.828	0.846	Q5NCE8.pdb.gz	MRS2_MOUSE Magnesium transporter MRS2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Mrs2 PE=2 SV=2
3	AFDB:Q058N4	0.594	0.576	2.238E-18	459	0.214	0.207	Q058N4.pdb.gz	MRS2B_ARATH Magnesium transporter MRS2-11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRS2-11 PE=1 SV=1
4	AFDB:Q02783	0.582	0.619	1.204E-17	413	0.223	0.240	Q02783.pdb.gz	LPE10_YEAST Mitochondrial inner membrane magnesium transporter MFM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MFM1 PE=1 SV=1
5	AFDB:P87149	0.593	0.619	1.397E-17	422	0.228	0.239	P87149.pdb.gz	MRS2_SCHPO Mitochondrial inner membrane magnesium transporter mrs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrs2 PE=3 SV=1
6	AFDB:Q9ZPR4	0.600	0.628	1.397E-17	421	0.187	0.197	Q9ZPR4.pdb.gz	MRS25_ARATH Magnesium transporter MRS2-5 OS=Arabidopsis thaliana OX=3702 GN=MRS2-5 PE=2 SV=1
7	AFDB:Q93ZD7	0.586	0.594	3.661E-16	436	0.201	0.204	Q93ZD7.pdb.gz	MRS24_ARATH Magnesium transporter MRS2-4 OS=Arabidopsis thaliana OX=3702 GN=MRS2-4 PE=2 SV=1
8	AFDB:Q01926	0.581	0.550	8.922E-16	470	0.192	0.181	Q01926.pdb.gz	MRS2_YEAST Magnesium transporter MRS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS2 PE=1 SV=2
9	AFDB:Q9S9N4	0.582	0.584	9.375E-16	442	0.214	0.215	Q9S9N4.pdb.gz	MRS21_ARATH Magnesium transporter MRS2-1 OS=Arabidopsis thaliana OX=3702 GN=MRS2-1 PE=2 SV=1
10	AFDB:Q9SAH0	0.593	0.593	9.375E-16	443	0.205	0.205	Q9SAH0.pdb.gz	MRS2A_ARATH Magnesium transporter MRS2-10 OS=Arabidopsis thaliana OX=3702 GN=MRS2-10 PE=2 SV=1
11	PDB:3jcfA	0.480	0.590	2.189E-5	349	0.079	0.100	3jcfA.pdb.gz
12	PDB:4cy4E	0.426	0.561	1.705E-3	317	0.115	0.161	4cy4E.pdb.gz
13	PDB:5n9yA	0.416	0.530	1.466E-1	327	0.111	0.150	5n9yA.pdb.gz
14	PDB:3c98B	0.189	0.341	2.072E-1	230	0.063	0.122	3c98B.pdb.gz
15	PDB:3geiC	0.092	0.127	2.177E-1	298	0.086	0.128	3geiC.pdb.gz
16	PDB:1qoyA	0.136	0.184	3.572E-1	303	0.056	0.083	1qoyA.pdb.gz
17	PDB:7nsuD	0.126	0.132	4.354E-1	420	0.050	0.052	7nsuD.pdb.gz
18	PDB:5xtcl	0.106	0.082	5.307E-1	603	0.108	0.080	5xtcl.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
19	PDB:6bm7E	0.085	0.126	5.859E-1	291	0.016	0.024	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.
20	PDB:7ajlAAA	0.105	0.150	6.797E-1	290	0.068	0.103	7ajlAAA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5NCE8	0.0	704	434	0.828	0.846	MRS2_MOUSE Magnesium transporter MRS2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Mrs2 PE=2 SV=2
2	Q9ET09	0.0	716	434	0.844	0.862	MRS2_RAT Magnesium transporter MRS2 homolog, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mrs2 PE=2 SV=1
3	Q9HD23	0.0	899	443	1.000	1.000	MRS2_HUMAN Magnesium transporter MRS2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=MRS2 PE=1 SV=1
4	P87149	1.19e-22	101	422	0.199	0.209	MRS2_SCHPO Mitochondrial inner membrane magnesium transporter mrs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrs2 PE=3 SV=1
5	Q02783	6.70e-22	99.4	413	0.196	0.211	LPE10_YEAST Mitochondrial inner membrane magnesium transporter MFM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MFM1 PE=1 SV=1
6	Q93ZD7	1.42e-21	98.6	436	0.212	0.216	MRS24_ARATH Magnesium transporter MRS2-4 OS=Arabidopsis thaliana OX=3702 GN=MRS2-4 PE=2 SV=1
7	Q304A0	2.31e-21	97.4	386	0.208	0.238	MRS27_ARATH Magnesium transporter MRS2-7 OS=Arabidopsis thaliana OX=3702 GN=MRS2-7 PE=2 SV=1
8	Q058N4	5.24e-18	88.2	459	0.194	0.187	MRS2B_ARATH Magnesium transporter MRS2-11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRS2-11 PE=1 SV=1
9	Q1PE39	3.77e-16	82.4	408	0.201	0.218	MRS26_ARATH Magnesium transporter MRS2-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MRS2-6 PE=2 SV=1
10	Q9FLG2	1.12e-15	80.9	394	0.201	0.226	MRS22_ARATH Magnesium transporter MRS2-2 OS=Arabidopsis thaliana OX=3702 GN=MRS2-2 PE=2 SV=1
11	Q9S9N4	1.44e-15	80.9	442	0.223	0.224	MRS21_ARATH Magnesium transporter MRS2-1 OS=Arabidopsis thaliana OX=3702 GN=MRS2-1 PE=2 SV=1
12	Q01926	5.86e-15	79.0	470	0.169	0.160	MRS2_YEAST Magnesium transporter MRS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS2 PE=1 SV=2
13	Q9SAH0	4.28e-13	73.2	443	0.208	0.208	MRS2A_ARATH Magnesium transporter MRS2-10 OS=Arabidopsis thaliana OX=3702 GN=MRS2-10 PE=2 SV=1
14	Q9ZPR4	7.81e-10	62.8	421	0.072	0.076	MRS25_ARATH Magnesium transporter MRS2-5 OS=Arabidopsis thaliana OX=3702 GN=MRS2-5 PE=2 SV=1
15	Q9LJN2	8.59e-08	56.6	484	0.072	0.066	MRS23_ARATH Magnesium transporter MRS2-3 OS=Arabidopsis thaliana OX=3702 GN=MRS2-3 PE=2 SV=1
16	I7HHE1	3.62e-07	54.7	418	0.183	0.194	I7HHE1_ORYSJ Magnesium transporter OS=Oryza sativa subsp. japonica OX=39947 GN=OsMGT1 PE=2 SV=1
17	Q6TLK4	0.41	35.8	869	0.054	0.028	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
18	P07942	3.0	32.7	1786	0.032	0.008	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
19	A1Z8W8	4.2	32.3	1983	0.032	0.007	A1Z8W8_DROME Gartenzwerg, isoform B OS=Drosophila melanogaster OX=7227 GN=garz PE=1 SV=1
20	A0A0B4K7N0	5.1	32.3	1741	0.032	0.008	A0A0B4K7N0_DROME Gartenzwerg, isoform C OS=Drosophila melanogaster OX=7227 GN=garz PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03379 CcmB	1.9e+02	12.8	CcmB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000030349

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000007404	0.694	Apolipoprotein A-I
2	9598.ENSPTRP00000030352	0.679	Uncharacterized protein
3	9598.ENSPTRP00000002493	0.677	Tyrosine-protein kinase receptor
4	9598.ENSPTRP00000054687	0.672	Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA)
5	9598.ENSPTRP00000027595	0.671	Uncharacterized protein
6	9598.ENSPTRP00000035829	0.670	Translocase of outer mitochondrial membrane 5 homolog (yeast)
7	9598.ENSPTRP00000060537	0.637	Apolipoprotein L, 6
8	9598.ENSPTRP00000003191	0.601	Solute carrier family 41, member 1
9	9598.ENSPTRP00000008549	0.595	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (Subunit 9)
10	9598.ENSPTRP00000021640	0.582	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (Subunit 9)
11	9598.ENSPTRP00000038428	0.559	Membrane magnesium transporter 1
12	9598.ENSPTRP00000004970	0.550	Uncharacterized protein
13	9598.ENSPTRP00000034384	0.550	Solute carrier family 25, member 37
14	9598.ENSPTRP00000045638	0.546	Inositol polyphosphate-5-phosphatase, 40kDa
15	9598.ENSPTRP00000023587	0.539	Uncharacterized protein
16	9598.ENSPTRP00000011273	0.535	Proteasome (Prosome, macropain) 26S subunit, ATPase, 1
17	9598.ENSPTRP00000009138	0.532	Solute carrier family 41, member 2
18	9598.ENSPTRP00000006962	0.530	Uncharacterized protein
19	9598.ENSPTRP00000005116	0.519	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015095	1.000	magnesium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006811	0.963	monoatomic ion transport
GO:0055085	0.955	transmembrane transport
GO:0044237	0.905	cellular metabolic process
GO:0098662	0.855	inorganic cation transmembrane transport
GO:0006812	0.825	monoatomic cation transport
GO:0098655	0.819	monoatomic cation transmembrane transport
GO:1990542	0.714	mitochondrial transmembrane transport
GO:0071704	0.566	organic substance metabolic process
GO:0030001	0.557	metal ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0031090	0.987	organelle membrane
GO:0031967	0.968	organelle envelope
GO:0031966	0.915	mitochondrial membrane
GO:0019866	0.829	organelle inner membrane
GO:0005743	0.789	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29827	1.000	Mg(2+)(in) = Mg(2+)(out)

[back to server]