StarFunc result for job id Q9HD26

User Input

>input (462 residues)
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BH60	0.733	0.731	5.849E-64	463	0.918	0.916	Q8BH60.pdb.gz	GOPC_MOUSE Golgi-associated PDZ and coiled-coil motif-containing protein OS=Mus musculus OX=10090 GN=Gopc PE=1 SV=1
2	AFDB:F5H1Y4	0.371	0.407	5.645E-44	407	0.881	1.000	F5H1Y4.pdb.gz	F5H1Y4_HUMAN Golgi associated PDZ and coiled-coil motif containing OS=Homo sapiens OX=9606 GN=GOPC PE=1 SV=2
3	AFDB:O18302	0.390	0.427	1.163E-32	414	0.452	0.505	O18302.pdb.gz	O18302_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gopc-1 PE=1 SV=2
4	AFDB:A0A2R8QIA2	0.194	0.432	1.877E-10	204	0.113	0.255	A0A2R8QIA2.pdb.gz
5	AFDB:Q13424	0.203	0.186	6.197E-10	505	0.113	0.103	Q13424.pdb.gz	SNTA1_HUMAN Alpha-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTA1 PE=1 SV=1
6	AFDB:A5PEX5	0.191	0.415	1.034E-9	209	0.110	0.244	A5PEX5.pdb.gz	A5PEX5_CAEEL Protein lin-7 homolog OS=Caenorhabditis elegans OX=6239 GN=lin-7 PE=1 SV=2
7	AFDB:Q9VBY7	0.197	0.452	1.455E-9	195	0.110	0.262	Q9VBY7.pdb.gz	Q9VBY7_DROME Protein lin-7 homolog OS=Drosophila melanogaster OX=7227 GN=veli PE=1 SV=1
8	AFDB:D3ZWC6	0.201	0.174	1.725E-9	539	0.113	0.096	D3ZWC6.pdb.gz	D3ZWC6_RAT Syntrophin, beta 1 OS=Rattus norvegicus OX=10116 GN=Sntb1 PE=1 SV=1
9	AFDB:A0A024R732	0.195	0.168	2.166E-9	540	0.106	0.091	A0A024R732.pdb.gz
10	AFDB:O88951	0.194	0.419	2.569E-9	207	0.110	0.246	O88951.pdb.gz	LIN7B_MOUSE Protein lin-7 homolog B OS=Mus musculus OX=10090 GN=Lin7b PE=1 SV=2
11	PDB:7p70A	0.177	0.200	1.612E-8	407	0.095	0.108	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
12	PDB:7qqnC	0.172	0.192	3.286E-7	414	0.067	0.075	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7pc3A	0.173	0.197	3.021E-6	405	0.069	0.079	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7p73A	0.183	0.201	2.341E-5	420	0.056	0.062	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:2xkxA	0.189	0.127	2.777E-5	721	0.080	0.051	2xkxA.pdb.gz
16	PDB:6t36A	0.172	0.771	3.111E-5	93	0.052	0.258	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
17	PDB:7pc5A	0.168	0.190	4.904E-5	405	0.069	0.079	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:5n7dA	0.166	0.181	9.704E-5	423	0.052	0.057	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
19	PDB:7qqmA	0.178	0.198	1.619E-4	413	0.054	0.061	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.173	0.192	4.023E-4	415	0.065	0.072	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H1Y4	0.0	778	407	0.864	0.980	F5H1Y4_HUMAN Golgi associated PDZ and coiled-coil motif containing OS=Homo sapiens OX=9606 GN=GOPC PE=1 SV=2
2	Q8BH60	0.0	827	463	0.874	0.873	GOPC_MOUSE Golgi-associated PDZ and coiled-coil motif-containing protein OS=Mus musculus OX=10090 GN=Gopc PE=1 SV=1
3	Q9HD26	0.0	939	462	1.000	1.000	GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC PE=1 SV=1
4	O18302	2.09e-134	395	414	0.444	0.495	O18302_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gopc-1 PE=1 SV=2
5	Q61235	8.59e-17	85.1	520	0.089	0.079	SNTB2_MOUSE Beta-2-syntrophin OS=Mus musculus OX=10090 GN=Sntb2 PE=1 SV=2
6	Q13425	8.89e-17	85.1	540	0.089	0.076	SNTB2_HUMAN Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1
7	Q9VNY4	1.42e-16	84.7	624	0.093	0.069	Q9VNY4_DROME Syntrophin-like 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Syn1 PE=3 SV=3
8	M9PGE3	1.44e-16	84.7	625	0.093	0.069	M9PGE3_DROME Syntrophin-like 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Syn1 PE=3 SV=1
9	Q9VNY2	1.47e-16	84.7	627	0.093	0.069	Q9VNY2_DROME IP02644p OS=Drosophila melanogaster OX=7227 GN=Syn1 PE=2 SV=3
10	A0A8I6GLN6	2.21e-16	83.6	514	0.097	0.088	A0A8I6GLN6_RAT Syntrophin, beta 1 OS=Rattus norvegicus OX=10116 GN=Sntb1 PE=1 SV=1
11	Q13884	2.23e-16	84.0	538	0.097	0.084	SNTB1_HUMAN Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3
12	Q99L88	2.66e-16	83.6	537	0.097	0.084	SNTB1_MOUSE Beta-1-syntrophin OS=Mus musculus OX=10090 GN=Sntb1 PE=1 SV=4
13	D3ZWC6	2.89e-16	83.6	539	0.097	0.083	D3ZWC6_RAT Syntrophin, beta 1 OS=Rattus norvegicus OX=10116 GN=Sntb1 PE=1 SV=1
14	Q93646	3.16e-15	79.7	440	0.097	0.102	SNT1_CAEEL Syntrophin-1 OS=Caenorhabditis elegans OX=6239 GN=stn-1 PE=1 SV=1
15	Q13424	4.02e-15	79.7	505	0.091	0.083	SNTA1_HUMAN Alpha-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTA1 PE=1 SV=1
16	A0A8J8Y1B9	1.61e-14	77.8	502	0.091	0.084	A0A8J8Y1B9_RAT Syntrophin, alpha 1 OS=Rattus norvegicus OX=10116 GN=Snta1 PE=1 SV=1
17	B5DFL0	1.62e-14	77.8	499	0.091	0.084	B5DFL0_RAT Snta1 protein OS=Rattus norvegicus OX=10116 GN=Snta1 PE=1 SV=1
18	Q28626	1.69e-14	77.8	505	0.091	0.083	SNTA1_RABIT Alpha-1-syntrophin OS=Oryctolagus cuniculus OX=9986 GN=SNTA1 PE=1 SV=1
19	Q61234	1.88e-14	77.8	503	0.091	0.083	SNTA1_MOUSE Alpha-1-syntrophin OS=Mus musculus OX=10090 GN=Snta1 PE=1 SV=1
20	Q9VBY7	2.02e-14	73.9	195	0.087	0.205	Q9VBY7_DROME Protein lin-7 homolog OS=Drosophila melanogaster OX=7227 GN=veli PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07716 bZIP_2	24	16.4	Basic region leucine zipper
2	PF04977 DivIC	1.9e+02	13.2	Septum formation initiator
3	PF13600 DUF4140	1.1e+02	14.7	N-terminal domain of unknown function (DUF4140)
4	PF19805 DUF6288	48	14.6	Family of unknown function (DUF6288)
5	PF06004 DUF903	88	14.5	Bacterial protein of unknown function (DUF903)
6	PF00595 PDZ	1.5e-13	62.2	PDZ domain
7	PF13180 PDZ_2	0.61	21.8	PDZ domain
8	PF17820 PDZ_6	1.4e-05	36.2	PDZ domain
9	PF02163 Peptidase_M50	1.7	19.4	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000003084	0.996	Cystic fibrosis transmembrane conductance regulator
2	9606.ENSP00000238738	0.996	Rho-related GTP-binding protein RhoQ
3	9606.ENSP00000355231	0.979	Beclin-1
4	9606.ENSP00000258301	0.948	Syntaxin-6
5	9606.ENSP00000373244	0.863	Chondroitin sulfate proteoglycan 5
6	9606.ENSP00000204726	0.817	Golgin subfamily A member 3
7	9606.ENSP00000272430	0.795	Rhotekin
8	9606.ENSP00000381768	0.784	Cadherin-23
9	9606.ENSP00000293897	0.783	Somatostatin receptor type 5
10	9606.ENSP00000300105	0.770	Voltage-dependent calcium channel gamma-2 subunit
11	9606.ENSP00000296955	0.757	Discoidin, CUB and LCCL domain containing 1
12	9606.ENSP00000313875	0.755	Membrane cofactor protein
13	9606.ENSP00000369213	0.743	Probable ATP-dependent RNA helicase DDX58
14	9606.ENSP00000354607	0.738	Frizzled-5
15	9606.ENSP00000282020	0.733	Glutamate receptor ionotropic, delta-2
16	9606.ENSP00000385205	0.718	PRKCA-binding protein
17	9606.ENSP00000357474	0.702	Centrosomal protein 85 like
18	9606.ENSP00000371483	0.700	Sodium-dependent phosphate transport protein 2B
19	9606.ENSP00000265070	0.698	Golgi phosphoprotein 3
20	9606.ENSP00000344456	0.695	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005102	0.713	signaling receptor binding
GO:0098772	0.693	molecular function regulator activity
GO:0005109	0.688	frizzled binding
GO:0046983	0.636	protein dimerization activity
GO:0042803	0.580	protein homodimerization activity
GO:0030234	0.576	enzyme regulator activity
GO:0030695	0.553	GTPase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0034762	0.865	regulation of transmembrane transport
GO:0048519	0.822	negative regulation of biological process
GO:0032501	0.803	multicellular organismal process
GO:0048523	0.792	negative regulation of cellular process
GO:0032409	0.736	regulation of transporter activity
GO:0060341	0.706	regulation of cellular localization
GO:0043269	0.700	regulation of monoatomic ion transport
GO:0032880	0.695	regulation of protein localization
GO:0008152	0.694	metabolic process
GO:0071840	0.648	cellular component organization or biogenesis
GO:0051051	0.627	negative regulation of transport
GO:0016043	0.609	cellular component organization
GO:0022898	0.597	regulation of transmembrane transporter activity
GO:0032502	0.595	developmental process
GO:0048856	0.592	anatomical structure development
GO:2000008	0.580	regulation of protein localization to cell surface
GO:0032412	0.557	regulation of monoatomic ion transmembrane transporter activity
GO:0032410	0.528	negative regulation of transporter activity
GO:0034765	0.522	regulation of monoatomic ion transmembrane transport
GO:0043271	0.518	negative regulation of monoatomic ion transport
GO:0071704	0.475	organic substance metabolic process
GO:0034763	0.470	negative regulation of transmembrane transport
GO:0044237	0.434	cellular metabolic process
GO:0044238	0.385	primary metabolic process
GO:0034766	0.331	negative regulation of monoatomic ion transmembrane transport
GO:1903828	0.326	negative regulation of protein localization
GO:0050896	0.322	response to stimulus
GO:0032413	0.300	negative regulation of ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005886	0.995	plasma membrane
GO:0005794	0.983	Golgi apparatus
GO:0031090	0.859	organelle membrane
GO:0031982	0.822	vesicle
GO:0030054	0.762	cell junction
GO:0098588	0.756	bounding membrane of organelle
GO:0097708	0.717	intracellular vesicle
GO:0031410	0.707	cytoplasmic vesicle
GO:0032991	0.501	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]