StarFunc result for job id Q9HD36

User Input

>input (204 residues)
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIH
RSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKK
WGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWR
KQLVQAFLSCLLTTAFIYLWTRLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HD36	1.000	1.000	6.671E-28	204	1.000	1.000	Q9HD36.pdb.gz	B2L10_HUMAN Bcl-2-like protein 10 OS=Homo sapiens OX=9606 GN=BCL2L10 PE=1 SV=3
2	AFDB:Q99M66	0.721	0.793	1.953E-14	185	0.431	0.476	Q99M66.pdb.gz	B2L10_RAT Bcl-2-like protein 10 OS=Rattus norvegicus OX=10116 GN=Bcl2l10 PE=1 SV=1
3	AFDB:Q9Z0F3	0.706	0.751	5.376E-13	191	0.451	0.482	Q9Z0F3.pdb.gz	B2L10_MOUSE Bcl-2-like protein 10 OS=Mus musculus OX=10090 GN=Bcl2l10 PE=1 SV=1
4	AFDB:Q568W6	0.586	0.589	4.736E-6	203	0.240	0.241	Q568W6.pdb.gz
5	AFDB:A2BF68	0.582	0.528	2.045E-5	228	0.162	0.145	A2BF68.pdb.gz
6	AFDB:D2Y5Q2	0.592	0.606	5.421E-5	199	0.191	0.196	D2Y5Q2.pdb.gz	D2Y5Q2_DANRE BCL-WAV OS=Danio rerio OX=7955 GN=bcl2l16 PE=2 SV=1
7	AFDB:Q7TS60	0.592	0.557	8.407E-5	219	0.206	0.192	Q7TS60.pdb.gz	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
8	AFDB:P97287	0.571	0.368	1.022E-4	331	0.201	0.124	P97287.pdb.gz	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
9	AFDB:Q1L8X3	0.551	0.451	1.437E-4	255	0.152	0.122	Q1L8X3.pdb.gz
10	AFDB:Q07820	0.593	0.362	1.664E-4	350	0.211	0.123	Q07820.pdb.gz	MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=3
11	PDB:4wmuA	0.505	0.222	4.236E-4	516	0.191	0.076	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
12	PDB:2b48A	0.337	0.454	3.800E-3	143	0.176	0.252	2b48A.pdb.gz
13	PDB:1o0lA	0.519	0.556	5.613E-3	188	0.225	0.245	1o0lA.pdb.gz
14	PDB:1lxlA	0.460	0.428	8.291E-3	221	0.186	0.172	1lxlA.pdb.gz
15	PDB:2k7wA	0.482	0.507	9.140E-3	192	0.225	0.240	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
16	PDB:7cclC	0.345	0.450	1.789E-1	147	0.142	0.197	7cclC.pdb.gz
17	PDB:6thaA	0.193	0.118	4.302E-1	448	0.123	0.056	6thaA.pdb.gz
18	PDB:6ji1A	0.206	0.130	7.722E-1	462	0.142	0.063	6ji1A.pdb.gz
19	PDB:7bp3A	0.201	0.143	1.257	394	0.132	0.069	7bp3A.pdb.gz
20	PDB:7zh0A	0.216	0.127	1.386	495	0.088	0.036	7zh0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HD36	4.01e-149	414	204	1.000	1.000	B2L10_HUMAN Bcl-2-like protein 10 OS=Homo sapiens OX=9606 GN=BCL2L10 PE=1 SV=3
2	Q99M66	1.41e-61	191	185	0.436	0.481	B2L10_RAT Bcl-2-like protein 10 OS=Rattus norvegicus OX=10116 GN=Bcl2l10 PE=1 SV=1
3	Q9Z0F3	2.47e-52	168	191	0.461	0.492	B2L10_MOUSE Bcl-2-like protein 10 OS=Mus musculus OX=10090 GN=Bcl2l10 PE=1 SV=1
4	Q8UWD5	1.53e-11	62.4	176	0.260	0.301	Q8UWD5_DANRE BCL2-like 10 OS=Danio rerio OX=7955 GN=NR-13 PE=1 SV=1
5	Q925A9	2.44e-06	48.1	175	0.172	0.200	Q925A9_RAT BCL2-related protein A1 OS=Rattus norvegicus OX=10116 GN=Bcl2a1 PE=2 SV=1
6	G3V977	1.42e-05	45.8	175	0.167	0.194	G3V977_RAT BCL2-related protein A1 OS=Rattus norvegicus OX=10116 GN=Bcl2a1 PE=3 SV=1
7	Q07440	1.64e-04	42.7	172	0.186	0.221	B2LA1_MOUSE Bcl-2-related protein A1 OS=Mus musculus OX=10090 GN=Bcl2a1 PE=1 SV=1
8	O55179	3.65e-04	42.0	172	0.167	0.198	O55179_MOUSE A1-d protein OS=Mus musculus OX=10090 GN=Bcl2a1d PE=2 SV=1
9	Q568W5	6.00e-04	41.6	228	0.176	0.158	Q568W5_DANRE MCL1 apoptosis regulator, BCL2 family member b OS=Danio rerio OX=7955 GN=zgc:109763 PE=2 SV=1
10	P70345	0.005	38.9	193	0.201	0.212	B2CL2_MOUSE Bcl-2-like protein 2 OS=Mus musculus OX=10090 GN=Bcl2l2 PE=1 SV=1
11	Q07812	0.010	38.1	192	0.167	0.177	BAX_HUMAN Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX PE=1 SV=1
12	Q92843	0.010	37.7	193	0.196	0.207	B2CL2_HUMAN Bcl-2-like protein 2 OS=Homo sapiens OX=9606 GN=BCL2L2 PE=1 SV=2
13	A0A087WT64	0.011	37.7	197	0.196	0.203	A0A087WT64_HUMAN MCL1 apoptosis regulator, BCL2 family member OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=1
14	Q9I9N4	0.013	37.7	192	0.162	0.172	Q9I9N4_DANRE BCL2-associated X, apoptosis regulator a OS=Danio rerio OX=7955 GN=bax PE=2 SV=1
15	O88996	0.016	37.4	193	0.196	0.207	O88996_RAT BCL-W OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
16	Q7TS60	0.021	37.0	219	0.196	0.183	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
17	P97287	0.027	37.0	331	0.123	0.076	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
18	Q07820	0.027	37.0	350	0.123	0.071	MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=3
19	Q07817	0.029	36.6	233	0.152	0.133	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
20	Q9Z1P3	0.029	37.0	330	0.123	0.076	MCL1_RAT Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Rattus norvegicus OX=10116 GN=Mcl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	2.3e-19	81.2	Apoptosis regulator proteins, Bcl-2 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376943	0.986	Bcl-2-like protein 11
2	9606.ENSP00000365576	0.914	Ubiquilin-1
3	9606.ENSP00000448165	0.855	Apoptotic protease-activating factor 1
4	9606.ENSP00000302564	0.833	Bcl-2-like protein 1
5	9606.ENSP00000326119	0.825	Phorbol-12-myristate-13-acetate-induced protein 1
6	9606.ENSP00000440864	0.823	Nuclear receptor subfamily 4 group A member 1
7	9606.ENSP00000250405	0.814	Bcl-2-like protein 2
8	9606.ENSP00000452479	0.807	BCL2L2-PABPN1 readthrough
9	9606.ENSP00000355231	0.806	Beclin-1
10	9606.ENSP00000216115	0.756	Bcl-2-interacting killer
11	9606.ENSP00000330237	0.748	Caspase-9
12	9606.ENSP00000267953	0.720	Bcl-2-related protein A1
13	9606.ENSP00000257572	0.712	Activator of apoptosis harakiri
14	9606.ENSP00000253083	0.708	Huntingtin-interacting protein 1-related protein
15	9606.ENSP00000358022	0.702	Induced myeloid leukemia cell differentiation protein Mcl-1
16	9606.ENSP00000346697	0.681	Bcl-2-modifying factor
17	9606.ENSP00000358814	0.655	S-adenosylhomocysteine hydrolase-like protein 1
18	9606.ENSP00000314132	0.654	Bcl-2-related ovarian killer protein
19	9606.ENSP00000293288	0.621	Apoptosis regulator BAX
20	9606.ENSP00000309132	0.595	Apoptosis facilitator Bcl-2-like protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.957	enzyme binding
GO:0089720	0.838	caspase binding
GO:0005509	0.830	calcium ion binding
GO:0042802	0.609	identical protein binding
GO:0019904	0.367	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0042981	0.989	regulation of apoptotic process
GO:0048518	0.985	positive regulation of biological process
GO:0012501	0.979	programmed cell death
GO:2001056	0.979	positive regulation of cysteine-type endopeptidase activity
GO:0043280	0.961	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006915	0.957	apoptotic process
GO:0048523	0.926	negative regulation of cellular process
GO:0032501	0.889	multicellular organismal process
GO:0032502	0.887	developmental process
GO:0043066	0.886	negative regulation of apoptotic process
GO:0050896	0.857	response to stimulus
GO:0048522	0.847	positive regulation of cellular process
GO:0006919	0.786	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051716	0.765	cellular response to stimulus
GO:0007276	0.619	gamete generation
GO:0048583	0.545	regulation of response to stimulus
GO:0007154	0.541	cell communication
GO:0023052	0.508	signaling
GO:0097190	0.486	apoptotic signaling pathway
GO:0043065	0.483	positive regulation of apoptotic process
GO:0003006	0.467	developmental process involved in reproduction
GO:0071840	0.434	cellular component organization or biogenesis
GO:0009966	0.417	regulation of signal transduction
GO:0016043	0.400	cellular component organization
GO:2001233	0.373	regulation of apoptotic signaling pathway
GO:1902531	0.364	regulation of intracellular signal transduction
GO:0048232	0.316	male gamete generation
GO:0007283	0.313	spermatogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0005829	0.997	cytosol
GO:0012505	0.995	endomembrane system
GO:0005783	0.930	endoplasmic reticulum
GO:0044232	0.785	organelle membrane contact site
GO:0044233	0.767	mitochondria-associated endoplasmic reticulum membrane
GO:0032991	0.499	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]