StarFunc result for job id Q9HD42

User Input

>input (196 residues)
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PHF0	0.905	0.896	4.655E-21	198	0.883	0.874	Q6PHF0.pdb.gz	CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio OX=7955 GN=chmp1a PE=2 SV=1
2	AFDB:Q921W0	0.646	0.646	4.683E-20	196	0.974	0.974	Q921W0.pdb.gz	CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus OX=10090 GN=Chmp1a PE=1 SV=1
3	AFDB:Q7LBR1	0.654	0.645	5.158E-13	199	0.561	0.553	Q7LBR1.pdb.gz	CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens OX=9606 GN=CHMP1B PE=1 SV=1
4	AFDB:Q95SH2	0.796	0.769	1.680E-12	203	0.500	0.483	Q95SH2.pdb.gz	Q95SH2_DROME Charged multivesicular body protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Chmp1 PE=1 SV=1
5	AFDB:Q8LE58	0.811	0.784	1.439E-11	203	0.423	0.409	Q8LE58.pdb.gz	CHM1A_ARATH ESCRT-related protein CHMP1A OS=Arabidopsis thaliana OX=3702 GN=CHMP1A PE=1 SV=1
6	AFDB:P69771	0.754	0.725	3.220E-11	204	0.480	0.461	P69771.pdb.gz	DID2_YEAST Vacuolar protein-sorting-associated protein 46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DID2 PE=1 SV=1
7	AFDB:Q9TXI3	0.527	0.505	4.212E-11	205	0.495	0.473	Q9TXI3.pdb.gz	Q9TXI3_CAEEL Charged multivesicular body protein 1b OS=Caenorhabditis elegans OX=6239 GN=did-2 PE=1 SV=1
8	PDB:6tz402	0.510	0.566	7.416E-11	176	0.520	0.580	6tz402.pdb.gz
9	AFDB:Q38DX7	0.515	0.488	1.056E-9	207	0.362	0.343	Q38DX7.pdb.gz	Q38DX7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1770 PE=4 SV=1
10	AFDB:O60074	0.552	0.542	1.806E-9	200	0.464	0.455	O60074.pdb.gz	DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=did2 PE=3 SV=2
11	AFDB:Q5AQN4	0.509	0.478	8.322E-5	209	0.250	0.234	Q5AQN4.pdb.gz	Q5AQN4_EMENI SNF7 family protein Fti1/Did2, putative (AFU_orthologue AFUA_3G04060) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09396 PE=4 SV=1
12	PDB:3rx6A	0.327	0.340	6.027E-1	187	0.148	0.155	3rx6A.pdb.gz
13	PDB:4xgsB	0.283	0.335	8.317E-1	164	0.071	0.085	4xgsB.pdb.gz	Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria
14	PDB:6c4iv	0.168	0.098	9.771E-1	362	0.066	0.036	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
15	PDB:1ka2A	0.210	0.097	1.031	497	0.097	0.038	1ka2A.pdb.gz	Crystal Structure of a Novel Carboxypeptidase from the Hyperthermophilic Archaeon Pyrococcus furiosus
16	PDB:7n6g3I	0.206	0.128	1.211	401	0.168	0.082	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
17	PDB:3bviF	0.266	0.296	1.278	173	0.082	0.092	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
18	PDB:7sqcO1	0.240	0.093	1.348	673	0.148	0.043	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:5gjr6	0.171	0.085	1.501	421	0.163	0.076	5gjr6.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:6xz6A	0.213	0.200	1.672	213	0.143	0.131	6xz6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HD42	3.64e-141	393	196	1.000	1.000	CHM1A_HUMAN Charged multivesicular body protein 1a OS=Homo sapiens OX=9606 GN=CHMP1A PE=1 SV=1
2	Q921W0	5.69e-137	382	196	0.974	0.974	CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus OX=10090 GN=Chmp1a PE=1 SV=1
3	Q6PHF0	1.76e-123	348	198	0.883	0.874	CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio OX=7955 GN=chmp1a PE=2 SV=1
4	Q9TXI3	2.33e-57	181	205	0.495	0.473	Q9TXI3_CAEEL Charged multivesicular body protein 1b OS=Caenorhabditis elegans OX=6239 GN=did-2 PE=1 SV=1
5	O60074	1.45e-55	176	200	0.464	0.455	DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=did2 PE=3 SV=2
6	Q7LBR1	6.44e-55	175	199	0.561	0.553	CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens OX=9606 GN=CHMP1B PE=1 SV=1
7	Q8LE58	1.72e-54	174	203	0.429	0.414	CHM1A_ARATH ESCRT-related protein CHMP1A OS=Arabidopsis thaliana OX=3702 GN=CHMP1A PE=1 SV=1
8	Q95SH2	2.27e-53	171	203	0.520	0.502	Q95SH2_DROME Charged multivesicular body protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Chmp1 PE=1 SV=1
9	P69771	4.55e-53	170	204	0.480	0.461	DID2_YEAST Vacuolar protein-sorting-associated protein 46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DID2 PE=1 SV=1
10	Q38DX7	5.37e-48	157	207	0.403	0.382	Q38DX7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1770 PE=4 SV=1
11	Q9SSM4	4.87e-47	155	203	0.449	0.433	CHM1B_ARATH ESCRT-related protein CHMP1B OS=Arabidopsis thaliana OX=3702 GN=CHMP1B PE=1 SV=1
12	Q5AQN4	3.55e-12	64.7	209	0.270	0.254	Q5AQN4_EMENI SNF7 family protein Fti1/Did2, putative (AFU_orthologue AFUA_3G04060) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09396 PE=4 SV=1
13	O43633	4.59e-11	61.6	222	0.230	0.203	CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1
14	Q9DB34	6.40e-11	61.2	222	0.230	0.203	CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus OX=10090 GN=Chmp2a PE=1 SV=1
15	Q9U2F6	3.58e-10	59.7	237	0.189	0.156	Q9U2F6_CAEEL Charged multivesicular body protein 2a OS=Caenorhabditis elegans OX=6239 GN=vps-2 PE=1 SV=1
16	Q9SKI2	9.75e-10	58.2	225	0.189	0.164	VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS2.1 PE=1 SV=2
17	Q9VBI3	1.92e-08	54.7	256	0.204	0.156	Q9VBI3_DROME RH72336p OS=Drosophila melanogaster OX=7227 GN=Vps2 PE=1 SV=1
18	Q8SXB1	1.97e-08	54.7	243	0.204	0.165	Q8SXB1_DROME GH16325p OS=Drosophila melanogaster OX=7227 GN=Vps2 PE=2 SV=1
19	Q386U8	1.48e-07	52.0	214	0.255	0.234	Q386U8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0015 PE=4 SV=1
20	Q0WTY4	2.03e-05	45.8	222	0.214	0.189	VPS2B_ARATH Vacuolar protein sorting-associated protein 2 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS2.2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19760 DUF6247	1.9e+02	13.6	Family of unknown function (DUF6247)
2	PF03398 Ist1	2.6e+02	12.9	Regulator of Vps4 activity in the MVB pathway
3	PF00924 MS_channel	1.9e+02	13.0	Mechanosensitive ion channel
4	PF03357 Snf7	1.6e-08	45.8	Snf7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254950	0.999	Vacuolar protein sorting-associated protein 4A
2	9606.ENSP00000438399	0.999	IST1 homolog
3	9606.ENSP00000238497	0.997	Vacuolar protein sorting-associated protein 4B
4	9606.ENSP00000217402	0.994	Charged multivesicular body protein 4b
5	9606.ENSP00000377633	0.992	STAM-binding protein
6	9606.ENSP00000469240	0.992	Charged multivesicular body protein 2a
7	9606.ENSP00000356602	0.991	Vacuolar protein sorting-associated protein VTA1 homolog
8	9606.ENSP00000223500	0.990	Charged multivesicular body protein 5
9	9606.ENSP00000474823	0.985	annotation not available
10	9606.ENSP00000263780	0.983	Charged multivesicular body protein 2b
11	9606.ENSP00000405575	0.980	Charged multivesicular body protein 3
12	9606.ENSP00000317468	0.979	Charged multivesicular body protein 6
13	9606.ENSP00000324205	0.963	Charged multivesicular body protein 4a
14	9606.ENSP00000253794	0.953	Vacuolar protein-sorting-associated protein 25
15	9606.ENSP00000289359	0.942	MIT domain-containing protein 1
16	9606.ENSP00000366565	0.941	Vacuolar protein sorting-associated protein 28 homolog
17	9606.ENSP00000380794	0.940	Charged multivesicular body protein 7
18	9606.ENSP00000297265	0.939	Charged multivesicular body protein 4c
19	9606.ENSP00000367299	0.936	Vacuolar protein-sorting-associated protein 36
20	9606.ENSP00000251968	0.933	Tumor susceptibility gene 101 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.860	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071985	0.984	multivesicular body sorting pathway
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0016043	0.976	cellular component organization
GO:0051641	0.965	cellular localization
GO:0060236	0.965	regulation of mitotic spindle organization
GO:0006511	0.961	ubiquitin-dependent protein catabolic process
GO:0007080	0.960	mitotic metaphase plate congression
GO:0007034	0.953	vacuolar transport
GO:0043162	0.949	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:1902115	0.926	regulation of organelle assembly
GO:0006998	0.921	nuclear envelope organization
GO:0022607	0.920	cellular component assembly
GO:0046755	0.915	viral budding
GO:0071763	0.910	nuclear membrane organization
GO:0019076	0.908	viral release from host cell
GO:0007041	0.907	lysosomal transport
GO:1902410	0.907	mitotic cytokinetic process
GO:0097352	0.907	autophagosome maturation
GO:0001778	0.883	plasma membrane repair
GO:0010824	0.880	regulation of centrosome duplication
GO:0032501	0.836	multicellular organismal process
GO:0032502	0.835	developmental process
GO:0048856	0.829	anatomical structure development
GO:0007275	0.756	multicellular organism development
GO:0048519	0.684	negative regulation of biological process
GO:0048731	0.569	system development
GO:0071709	0.498	membrane assembly
GO:0048523	0.481	negative regulation of cellular process
GO:0019222	0.451	regulation of metabolic process
GO:0060255	0.412	regulation of macromolecule metabolic process
GO:0048518	0.323	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005768	0.999	endosome
GO:0031981	0.997	nuclear lumen
GO:0032991	0.996	protein-containing complex
GO:0005770	0.992	late endosome
GO:0010008	0.992	endosome membrane
GO:0005576	0.988	extracellular region
GO:0005829	0.987	cytosol
GO:0071944	0.986	cell periphery
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005886	0.982	plasma membrane
GO:0005773	0.966	vacuole
GO:0015630	0.961	microtubule cytoskeleton
GO:0005694	0.952	chromosome
GO:0070062	0.935	extracellular exosome
GO:0005774	0.842	vacuolar membrane
GO:0031902	0.841	late endosome membrane
GO:0005771	0.819	multivesicular body
GO:0005819	0.812	spindle
GO:0000421	0.785	autophagosome membrane
GO:0032585	0.784	multivesicular body membrane
GO:0099080	0.783	supramolecular complex
GO:0005828	0.766	kinetochore microtubule
GO:0031967	0.725	organelle envelope
GO:0000779	0.718	condensed chromosome, centromeric region
GO:0036452	0.678	ESCRT complex
GO:0000776	0.669	kinetochore
GO:0140513	0.640	nuclear protein-containing complex
GO:0030496	0.609	midbody
GO:0005635	0.584	nuclear envelope
GO:0005643	0.524	nuclear pore
GO:0005764	0.519	lysosome
GO:0098852	0.510	lytic vacuole membrane
GO:0005765	0.496	lysosomal membrane
GO:0098796	0.480	membrane protein complex
GO:0005654	0.363	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]