StarFunc result for job id Q9HD43

User Input

>input (1115 residues)
MAGAGGGLGVWGNLVLLGLCSWTGARAPAPNPGRNLTVETQTTSSISLSWEVPDGLDSQN
SNYWVQCTGDGGTTETRNTTATNVTVDGLGPGSLYTCSVWVEKDGVNSSVGTVTTATAPN
PVRNLRVEAQTNSSIALTWEVPDGPDPQNSTYGVEYTGDGGRAGTRSTAHTNITVDGLEP
GCLYAFSMWVGKNGINSSRETRNATTAHNPVRNLRVEAQTTSSISLSWEVPDGTDPQNST
YCVQCTGDGGRTETRNTTDTRVTVDGLGPGSLYTCSVWVEKDGVNSSVEIVTSATAPNPV
RNLTVEAQTNSSIALTWEVPDGPDPQNSTYGVEYTGDGGRAGTRSTAHTNITVDRLEPGC
LYVFSVWVGKNGINSSRETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYW
VEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTS
LSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSL
YHLTVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWV
QWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLC
ASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLG
LGPARSYPATITTIWDGMKVVSHSVVCHTESAGVIAGAFVGILLFLILVGLLIFFLKRRN
KKKQQKPELRDLVFSSPGDIPAEDFADHVRKNERDSNCGFADEYQQLSLVGHSQSQMVAS
ASENNAKNRYRNVLPYDWSRVPLKPIHEEPGSDYINASFMPGLWSPQEFIATQGPLPQTV
GDFWRLVWEQQSHTLVMLTNCMEAGRVKCEHYWPLDSQPCTHGHLRVTLVGEEVMENWTV
RELLLLQVEEQKTLSVRQFHYQAWPDHGVPSSPDTLLAFWRMLRQWLDQTMEGGPPIVHC
SAGVGRTGTLIALDVLLRQLQSEGLLGPFSFVRKMRESRPLMVQTEAQYVFLHQCILRFL
QQSAQAPAEKEVPYEDVENLIYENVAAIQAHKLEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q0N2	0.392	0.444	0.000	971	0.503	0.578	E9Q0N2.pdb.gz	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
2	AFDB:Q9HD43	1.000	1.000	0.000	1115	1.000	1.000	Q9HD43.pdb.gz	PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens OX=9606 GN=PTPRH PE=1 SV=4
3	AFDB:Q12913	0.291	0.248	1.950E-77	1337	0.271	0.226	Q12913.pdb.gz	PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3
4	AFDB:B6HY54	0.259	0.182	2.360E-77	1650	0.289	0.195	B6HY54.pdb.gz	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
5	AFDB:Q62884	0.332	0.308	5.212E-76	1216	0.267	0.245	Q62884.pdb.gz	Q62884_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 PE=1 SV=1
6	AFDB:Q64455	0.367	0.336	6.703E-74	1238	0.263	0.237	Q64455.pdb.gz	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
7	AFDB:Q9W4F5	0.251	0.159	2.159E-69	1767	0.256	0.161	Q9W4F5.pdb.gz	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
8	AFDB:A0A0H2UKT5	0.247	0.145	4.917E-67	1914	0.236	0.137	A0A0H2UKT5.pdb.gz
9	AFDB:B0V2N1	0.247	0.145	2.257E-66	1907	0.239	0.139	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
10	AFDB:A4IFW2	0.248	0.146	2.482E-66	1909	0.242	0.141	A4IFW2.pdb.gz	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
11	PDB:3ps5A	0.249	0.515	9.005E-22	529	0.110	0.233	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
12	PDB:4gwfA	0.246	0.542	6.344E-21	497	0.117	0.262	4gwfA.pdb.gz
13	PDB:5xzrA	0.245	0.516	9.285E-21	519	0.099	0.212	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:6krwA	0.229	0.795	3.510E-17	306	0.085	0.310	6krwA.pdb.gz
15	PDB:6h03A	0.098	0.093	3.290E-16	1223	0.069	0.063	6h03A.pdb.gz
16	PDB:7q5zA	0.112	0.098	3.234E-15	1344	0.074	0.061	7q5zA.pdb.gz
17	PDB:7q1yA	0.107	0.094	4.104E-15	1374	0.080	0.065	7q1yA.pdb.gz
18	PDB:5oj2B	0.136	0.195	1.975E-14	692	0.082	0.132	5oj2B.pdb.gz
19	PDB:5a42A	0.108	0.084	5.119E-14	1597	0.079	0.055	5a42A.pdb.gz
20	PDB:3m4uA	0.216	0.776	1.765E-13	285	0.074	0.288	3m4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q0N2	0.0	1067	971	0.502	0.577	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
2	Q9HD43	0.0	2294	1115	1.000	1.000	PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens OX=9606 GN=PTPRH PE=1 SV=4
3	Q12913	3.62e-113	384	1337	0.279	0.233	PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3
4	Q62884	3.29e-94	329	1216	0.140	0.128	Q62884_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 PE=1 SV=1
5	Q64455	1.13e-93	328	1238	0.140	0.126	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
6	B6HY54	1.78e-88	316	1650	0.137	0.093	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
7	A0A8I5ZXS1	6.56e-86	308	2238	0.160	0.080	A0A8I5ZXS1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
8	A0A0G2K2W0	8.94e-86	308	2240	0.160	0.079	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
9	D3ZTG5	1.18e-85	308	2004	0.160	0.089	D3ZTG5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=3
10	A0A8I5ZV35	1.32e-85	308	2000	0.160	0.089	A0A8I5ZV35_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
11	B2RU80	3.28e-85	306	1998	0.143	0.080	PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus OX=10090 GN=Ptprb PE=1 SV=1
12	P23467	1.55e-81	295	1997	0.137	0.077	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
13	P70289	3.33e-81	294	1705	0.140	0.091	PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus OX=10090 GN=Ptprv PE=1 SV=1
14	A0A0R4ITJ9	2.10e-78	285	1892	0.130	0.077	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
15	Q16827	3.30e-78	283	1216	0.126	0.116	PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase O OS=Homo sapiens OX=9606 GN=PTPRO PE=1 SV=2
16	Q28613	2.72e-77	280	1187	0.117	0.110	Q28613_RABIT protein-tyrosine-phosphatase OS=Oryctolagus cuniculus OX=9986 GN=PTPRO PE=2 SV=1
17	F7F9Z5	4.23e-77	279	1215	0.126	0.116	F7F9Z5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
18	Q62797	4.94e-77	279	1216	0.126	0.116	Q62797_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
19	Q98945	6.56e-77	279	1267	0.124	0.109	Q98945_CHICK protein-tyrosine-phosphatase OS=Gallus gallus OX=9031 PE=1 SV=1
20	A0A8I5YC57	6.79e-77	278	1188	0.121	0.114	A0A8I5YC57_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17048 Ceramidse_alk_C	13	17.0	Neutral/alkaline non-lysosomal ceramidase, C-terminal
2	PF00782 DSPc	36	15.6	Dual specificity phosphatase, catalytic domain
3	PF00041 fn3	6.4e-54	191.6	Fibronectin type III domain
4	PF09294 Interfer-bind	9.6e-06	37.2	Interferon-alpha/beta receptor, fibronectin type III
5	PF14041 Lipoprotein_21	45	15.6	LppP/LprE lipoprotein
6	PF10179 NDNF	3.1e-06	38.7	Neuron-derived neurotrophic factor, first Fn(III) domain
7	PF14566 PTPlike_phytase	2.7e+02	13.1	Inositol hexakisphosphate
8	PF16656 Pur_ac_phosph_N	4.1e-08	45.1	Purple acid Phosphatase, N-terminal domain
9	PF14292 SusE	7.8e-06	37.5	SusE outer membrane protein
10	PF01034 Syndecan	29	16.0	Syndecan domain
11	PF00102 Y_phosphatase	1.3e-73	259.1	Protein-tyrosine phosphatase
12	PF13350 Y_phosphatase3	10	17.7	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280362	0.743	6-pyruvoyl tetrahydrobiopterin synthase
2	9606.ENSP00000481937	0.574	Carcinoembryonic antigen-related cell adhesion molecule 20
3	9606.ENSP00000279907	0.555	UHRF1-binding protein 1-like
4	9606.ENSP00000261530	0.534	G patch domain-containing protein 2-like
5	9606.ENSP00000361625	0.506	Dolichyldiphosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0005001	1.000	transmembrane receptor protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0036211	0.976	protein modification process
GO:0006796	0.973	phosphate-containing compound metabolic process
GO:0006470	0.959	protein dephosphorylation
GO:0050794	0.865	regulation of cellular process
GO:0050896	0.376	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.997	cell periphery
GO:0005886	0.994	plasma membrane
GO:0043226	0.310	organelle
GO:0043227	0.303	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]