StarFunc result for job id Q9HD67

User Input

>input (2058 residues)
MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPT
NEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQ
YSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTI
SDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSAE
LLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR
IKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVA
VNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYS
GMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVRGKCTSLLQLYDASNSEWQLG
KTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNYRAFL
LRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERERE
RERREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDL
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERS
LSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRT
SGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSVQDSGSLHNSSSGESTYCMPQNAG
DLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSVGTYNSSGAYRFSSEG
AQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLK
DETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGT
VEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIQEMH
DEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQ
RSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLG
TLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKA
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDK
GYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHP
GSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK
CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRN
MFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKD
SVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRL
KARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEVSSA
RASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAV
SVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMI
VKKRYSTTRSASSQGSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VQB6	0.412	0.412	0.000	2062	0.944	0.942	F8VQB6.pdb.gz	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
2	AFDB:I3ITL5	0.425	0.428	0.000	2041	0.612	0.617	I3ITL5.pdb.gz	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
3	AFDB:F4JIU4	0.329	0.584	3.156E-62	1134	0.139	0.253	F4JIU4.pdb.gz	MYO4_ARATH Myosin-4 OS=Arabidopsis thaliana OX=3702 GN=VIII-B PE=3 SV=1
4	AFDB:A7E2Y1	0.348	0.361	4.687E-62	1983	0.155	0.160	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
5	AFDB:P02567	0.348	0.369	1.593E-58	1938	0.155	0.164	P02567.pdb.gz	MYO1_CAEEL Myosin-1 OS=Caenorhabditis elegans OX=6239 GN=myo-1 PE=1 SV=3
6	AFDB:P42522	0.313	0.535	1.593E-58	1182	0.135	0.234	P42522.pdb.gz	MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoC PE=1 SV=2
7	PDB:4anjA	0.320	0.648	8.157E-57	995	0.130	0.269	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
8	PDB:4pa0A	0.295	0.600	1.620E-55	974	0.131	0.276	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
9	PDB:4pa0B	0.294	0.631	1.202E-53	920	0.129	0.288	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
10	PDB:6ycxB	0.333	0.806	1.936E-50	817	0.115	0.289	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
11	PDB:4p7hB	0.293	0.611	2.023E-50	952	0.124	0.269	4p7hB.pdb.gz
12	PDB:7mf3B	0.336	0.736	2.931E-46	896	0.150	0.345	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
13	PDB:5tbyA	0.330	0.671	1.777E-45	954	0.150	0.323	5tbyA.pdb.gz
14	AFDB:Q8C115	0.218	0.292	4.870E-36	1491	0.106	0.147	Q8C115.pdb.gz	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
15	PDB:4rm8A	0.117	0.539	3.112E-11	368	0.026	0.144	4rm8A.pdb.gz
16	AFDB:A0A286YBL8	0.118	0.194	5.248E-7	1204	0.028	0.048	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
17	PDB:3ljuX	0.049	0.243	1.086E-6	373	0.020	0.113	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
18	PDB:7c3mA	0.103	0.320	4.633E-6	577	0.025	0.090	7c3mA.pdb.gz
19	AFDB:A0T1Z4	0.107	0.221	2.299E-5	932	0.026	0.057	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
20	AFDB:Q9H329	0.106	0.227	4.445E-5	900	0.022	0.050	Q9H329.pdb.gz	E41LB_HUMAN Band 4.1-like protein 4B OS=Homo sapiens OX=9606 GN=EPB41L4B PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MQX1	4283	2069	0.999	0.994	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
2	A0A8I5ZWB0	664	2238	0.182	0.167	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
3	A0A8J8XYU9	664	2215	0.182	0.169	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
4	E9PEW5	2908	1397	0.679	1.000	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
5	F8VQB6	3941	2062	0.944	0.942	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
6	I3ITL5	2521	2041	0.614	0.619	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
7	P79114	3846	2052	0.926	0.929	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
8	P91443	624	2098	0.171	0.167	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
9	P97479	673	2215	0.186	0.173	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
10	Q13402	665	2215	0.184	0.171	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
11	Q6PIF6	619	2116	0.160	0.156	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
12	Q7YU72	636	1035	0.171	0.339	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
13	Q8CJE3	664	2177	0.182	0.172	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
14	Q8IPH6	637	1033	0.171	0.340	Q8IPH6_DROME FI20293p1 OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=2
15	Q8IPH7	637	1034	0.171	0.339	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
16	Q8IPH8	637	2122	0.172	0.167	Q8IPH8_DROME Myosin 28B1, isoform B OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=1
17	Q99MZ6	617	2113	0.166	0.162	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
18	Q9DGG9	664	2179	0.181	0.171	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
19	Q9HD67	4295	2058	1.000	1.000	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
20	Q9NH54	637	2121	0.172	0.167	Q9NH54_DROME Myosin VIIB OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	1.6e+02	13.9	AAA domain
2	PF00887 ACBP	47	15.8	Acyl CoA binding protein
3	PF04684 BAF1_ABF1	1.1e+02	13.3	BAF1 / ABF1 chromatin reorganising factor
4	PF00373 FERM_M	1.5e-16	72.2	FERM central domain
5	PF00612 IQ	3.4e-05	34.2	IQ calmodulin-binding motif
6	PF16735 MYO10_CC	1.9e-13	61.6	Unconventional myosin-X coiled coil domain
7	PF00063 Myosin_head	5.7e-232	783.4	Myosin head (motor domain)
8	PF00784 MyTH4	4.3e-24	96.3	MyTH4 domain
9	PF00169 PH	2.6e-29	113.2	PH domain
10	PF15413 PH_11	0.0033	29.3	Pleckstrin homology domain
11	PF20399 PH_20	0.24	22.9	PH domain
12	PF14593 PH_3	2.3e-06	38.9	PH domain
13	PF15409 PH_8	8.2e-08	43.8	Pleckstrin homology domain
14	PF00788 RA	0.13	24.3	Ras association (RalGDS/AF-6) domain
15	PF18597 SH3_19	3.8e-22	89.2	Myosin X N-terminal SH3 domain
16	PF06088 TLP-20	1.2e+02	14.1	Nucleopolyhedrovirus telokin-like protein-20 (TLP20)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421280

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389140	0.980	Netrin receptor DCC
2	9606.ENSP00000291295	0.949	Calmodulin 3 (phosphorylase kinase, delta)
3	9606.ENSP00000315299	0.947	Calmodulin-like protein 3
4	9606.ENSP00000452786	0.947	Integrin beta-3
5	9606.ENSP00000173229	0.926	Netrin-1
6	9606.ENSP00000349467	0.894	Calmodulin-1
7	9606.ENSP00000341198	0.873	Neogenin
8	9606.ENSP00000355645	0.873	Actin, alpha skeletal muscle
9	9606.ENSP00000272298	0.860	Calmodulin 2 (phosphorylase kinase, delta)
10	9606.ENSP00000379350	0.843	Integrin beta-1
11	9606.ENSP00000296181	0.801	Integrin beta-5
12	9606.ENSP00000458162	0.720	Actin, cytoplasmic 2
13	9606.ENSP00000349960	0.708	Actin, cytoplasmic 1
14	9606.ENSP00000295685	0.698	Actin-related protein 2/3 complex subunit 2
15	9606.ENSP00000228825	0.692	Actin-related protein 2/3 complex subunit 3
16	9606.ENSP00000380948	0.690	Integrin beta-2
17	9606.ENSP00000294742	0.689	Actin-related protein 2/3 complex subunit 5
18	9606.ENSP00000367220	0.688	Actin-related protein 2
19	9606.ENSP00000263238	0.682	Actin-related protein 3
20	9606.ENSP00000388169	0.681	Actin-related protein 2/3 complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.998	protein-containing complex binding
GO:0008092	0.998	cytoskeletal protein binding
GO:0003774	0.659	cytoskeletal motor activity
GO:0003779	0.637	actin binding
GO:0000146	0.546	microfilament motor activity
GO:0043167	0.505	ion binding
GO:0097159	0.404	organic cyclic compound binding
GO:0043168	0.379	anion binding
GO:0036094	0.366	small molecule binding
GO:0030507	0.359	spectrin binding
GO:1901363	0.356	heterocyclic compound binding
GO:0005543	0.352	phospholipid binding
GO:0032553	0.331	ribonucleotide binding
GO:0035091	0.329	phosphatidylinositol binding
GO:0032559	0.317	adenyl ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0022603	0.992	regulation of anatomical structure morphogenesis
GO:0060491	0.992	regulation of cell projection assembly
GO:0009987	0.987	cellular process
GO:0022604	0.981	regulation of cell morphogenesis
GO:0051489	0.981	regulation of filopodium assembly
GO:0008360	0.973	regulation of cell shape
GO:0048518	0.730	positive regulation of biological process
GO:0048522	0.678	positive regulation of cellular process
GO:0071840	0.615	cellular component organization or biogenesis
GO:0016043	0.591	cellular component organization
GO:0050896	0.560	response to stimulus
GO:0032501	0.386	multicellular organismal process
GO:0032502	0.377	developmental process
GO:0051716	0.361	cellular response to stimulus
GO:0048856	0.347	anatomical structure development
GO:0051179	0.333	localization
GO:0048870	0.310	cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0031981	0.997	nuclear lumen
GO:0071944	0.996	cell periphery
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005886	0.992	plasma membrane
GO:0005856	0.916	cytoskeleton
GO:0120025	0.900	plasma membrane bounded cell projection
GO:0005654	0.733	nucleoplasm
GO:0005730	0.542	nucleolus
GO:0032991	0.465	protein-containing complex
GO:0098858	0.333	actin-based cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.546	myosin ATPase.

[back to server]