StarFunc result for job id Q9HD90

User Input

>input (331 residues)
MSKTFVKSKEMGELVNTPSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
LPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQA
GTPRYDVPIDMSYDSYPHHGIGTQLNTVFTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HD90	1.000	1.000	3.856E-46	331	1.000	1.000	Q9HD90.pdb.gz	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
2	AFDB:D4A7M5	0.503	0.504	2.086E-40	330	0.873	0.876	D4A7M5.pdb.gz	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
3	AFDB:O42202	0.375	0.359	2.085E-24	350	0.517	0.489	O42202.pdb.gz	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
4	AFDB:Q91616	0.371	0.351	7.570E-24	352	0.514	0.483	Q91616.pdb.gz	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
5	AFDB:Q6NYU3	0.367	0.371	1.315E-19	327	0.390	0.394	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
6	AFDB:P48986	0.337	0.331	1.128E-18	337	0.429	0.421	P48986.pdb.gz	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
7	AFDB:A0A2R8RRI1	0.192	0.133	2.020E-3	493	0.160	0.108	A0A2R8RRI1.pdb.gz	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
8	AFDB:Q2QMM0	0.194	0.239	3.301E-3	266	0.169	0.211	Q2QMM0.pdb.gz	Q2QMM0_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g40710 PE=3 SV=1
9	AFDB:Q0VG99	0.166	0.139	1.127E-2	397	0.184	0.154	Q0VG99.pdb.gz	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
10	AFDB:Q0D311	0.182	0.151	2.083E-2	403	0.175	0.144	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
11	PDB:7ungB0	0.073	0.097	1.756	193	0.076	0.130	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:4jdqF	0.084	0.227	2.539	90	0.045	0.167	4jdqF.pdb.gz
13	PDB:2be4A	0.125	0.148	2.871	270	0.033	0.041	2be4A.pdb.gz
14	PDB:5nr5A	0.098	0.198	3.052	113	0.036	0.106	5nr5A.pdb.gz
15	PDB:6mzcK	0.101	0.152	3.451	202	0.045	0.074	6mzcK.pdb.gz
16	PDB:7rroF0	0.125	0.256	4.149	139	0.048	0.115	7rroF0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:5fgiN	0.112	0.166	4.988	213	0.024	0.038	5fgiN.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
18	PDB:7sc9AR	0.097	0.180	4.988	160	0.051	0.106	7sc9AR.pdb.gz	Structures of a phycobilisome in light-harvesting and photoprotected states.
19	PDB:4d2eE	0.088	0.276	5.304	90	0.027	0.100	4d2eE.pdb.gz	Cell-Free Expression and in Meso Crystallisation of an Integral Membrane Kinase for Structure Determination.
20	PDB:4v7oAJ	0.102	0.133	5.304	250	0.009	0.012	4v7oAJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A7M5	0.0	565	330	0.873	0.876	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
2	O09105	0.0	550	330	0.885	0.888	NDF4_MOUSE Neurogenic differentiation factor 4 OS=Mus musculus OX=10090 GN=Neurod4 PE=1 SV=1
3	Q9HD90	0.0	684	331	1.000	1.000	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
4	P79920	4.72e-130	375	315	0.607	0.638	NDF4_XENLA Neurogenic differentiation factor 4 OS=Xenopus laevis OX=8355 GN=neurod4 PE=1 SV=1
5	Q13562	9.36e-105	312	356	0.562	0.522	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3
6	Q60867	2.44e-104	311	357	0.565	0.524	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
7	Q64289	3.45e-104	311	357	0.568	0.527	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
8	F1QWM8	9.22e-101	302	348	0.589	0.560	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
9	O42202	5.82e-98	295	350	0.444	0.420	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
10	Q91616	4.64e-95	288	352	0.450	0.423	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
11	P79765	2.88e-87	268	357	0.450	0.417	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
12	P48986	5.86e-71	225	337	0.381	0.374	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
13	Q6NYU3	2.74e-66	213	327	0.350	0.355	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
14	Q15784	5.19e-64	209	382	0.387	0.335	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2
15	Q62414	5.50e-64	209	383	0.387	0.334	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
16	P46581	9.16e-30	114	192	0.166	0.286	NDF1_CAEEL Neurogenic differentiation factor 1 OS=Caenorhabditis elegans OX=6239 GN=cnd-1 PE=2 SV=1
17	O42606	3.76e-21	91.7	208	0.136	0.216	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
18	Q92886	5.70e-19	86.7	237	0.190	0.266	NGN1_HUMAN Neurogenin-1 OS=Homo sapiens OX=9606 GN=NEUROG1 PE=1 SV=2
19	P70660	5.03e-18	84.0	244	0.118	0.160	NGN1_MOUSE Neurogenin-1 OS=Mus musculus OX=10090 GN=Neurog1 PE=1 SV=1
20	P70661	6.54e-18	83.2	214	0.124	0.192	NGN3_MOUSE Neurogenin-3 OS=Mus musculus OX=10090 GN=Neurog3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15794 CCDC106	0.3	22.3	Coiled-coil domain-containing protein 106
2	PF00010 HLH	5.7e-12	56.7	Helix-loop-helix DNA-binding domain
3	PF12533 Neuro_bHLH	2.6e-39	146.7	Neuronal helix-loop-helix transcription factor
4	PF15746 TMEM215	6.6e+02	11.1	TMEM215 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299162	0.856	Forkhead box protein N4
2	9606.ENSP00000261980	0.688	Visual system homeobox 2
3	9606.ENSP00000360811	0.652	LIM/homeobox protein Lhx3
4	9606.ENSP00000331741	0.641	Homeobox protein Hox-B2
5	9606.ENSP00000359474	0.640	BarH-like 2 homeobox protein
6	9606.ENSP00000367714	0.625	Transcription factor HES-5
7	9606.ENSP00000266744	0.621	Achaete-scute homolog 1
8	9606.ENSP00000222718	0.615	Homeobox protein Hox-A2
9	9606.ENSP00000281321	0.593	POU domain, class 4, transcription factor 2
10	9606.ENSP00000230658	0.575	Insulin gene enhancer protein ISL-1
11	9606.ENSP00000404100	0.568	Paired box protein Pax-6
12	9606.ENSP00000221996	0.556	Cone-rod homeobox protein
13	9606.ENSP00000355925	0.539	Prospero homeobox protein 1
14	9606.ENSP00000366413	0.533	POU domain, class 4, transcription factor 1
15	9606.ENSP00000260653	0.529	Homeobox protein SIX3
16	9606.ENSP00000226382	0.502	Paired mesoderm homeobox protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.982	DNA binding
GO:0003690	0.966	double-stranded DNA binding
GO:0043565	0.953	sequence-specific DNA binding
GO:0003700	0.934	DNA-binding transcription factor activity
GO:1990837	0.919	sequence-specific double-stranded DNA binding
GO:0000981	0.858	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.825	transcription cis-regulatory region binding
GO:0000977	0.685	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.638	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.618	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.400	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.999	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0050794	0.995	regulation of cellular process
GO:0007275	0.989	multicellular organism development
GO:0048522	0.985	positive regulation of cellular process
GO:0048731	0.980	system development
GO:0048513	0.920	animal organ development
GO:0050793	0.763	regulation of developmental process
GO:0045595	0.720	regulation of cell differentiation
GO:0007399	0.710	nervous system development
GO:0051094	0.697	positive regulation of developmental process
GO:0007423	0.662	sensory organ development
GO:0009987	0.661	cellular process
GO:0001654	0.634	eye development
GO:0019222	0.618	regulation of metabolic process
GO:0010468	0.611	regulation of gene expression
GO:0006355	0.601	regulation of DNA-templated transcription
GO:0007417	0.558	central nervous system development
GO:0045597	0.518	positive regulation of cell differentiation
GO:0006357	0.496	regulation of transcription by RNA polymerase II
GO:0043010	0.487	camera-type eye development
GO:0010604	0.451	positive regulation of macromolecule metabolic process
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0031325	0.422	positive regulation of cellular metabolic process
GO:0045944	0.390	positive regulation of transcription by RNA polymerase II
GO:0030154	0.381	cell differentiation
GO:0050896	0.352	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.968	nucleoplasm
GO:0005737	0.461	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]