StarFunc result for job id Q9NNW5

User Input

>input (1121 residues)
MDALEDYVWPRATSELILLPVTGLECVGDRLLAGEGPDVLVYSLDFGGHLRMIKRVQNLL
GHYLIHGFRVRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELWRSGLWNMSDWIW
DARWLEGNIALALGHNSVVLYDPVVGCILQEVPCTDRCTLSSACLIGDAWKELTIVAGAV
SNQLLVWYPATALADNKPVAPDRRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKVGD
LRVPGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVCLVWSHEGEILQAFRGHQGRG
IRAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSW
RLLAVTDTGALYLYDVEVKCWEQLLEDKHFQSYCLLEAAPGPEGFGLCAMANGEGRVKVV
PINTPTAAVDQTLFPGKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKE
RCRYLLPPSKQRWHTCSAFLPPGDFLVCGDRRGSVLLFPSRPGLLKDPGVGGKARAGAGA
PVVGSGSSGGGNAFTGLGPVSTLPSLHGKQGVTSVTCHGGYVYTTGRDGAYYQLFVRDGQ
LQPVLRQKSCRGMNWLAGLRIVPDGSMVILGFHANEFVVWNPRSHEKLHIVNCGGGHRSW
AFSDTEAAMAFAYLKDGDVMLYRALGGCTRPHVILREGLHGREITCVKRVGTITLGPEYG
VPSFMQPDDLEPGSEGPDLTDIVITCSEDTTVCVLALPTTTGSAHALTAVCNHISSVRAV
AVWGIGTPGGPQDPQPGLTAHVVSAGGRAEMHCFSIMVTPDPSTPSRLACHVMHLSSHRL
DEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRIL
QLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPP
VDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE
EAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTF
MNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087X295	0.984	0.959	0.000	1151	1.000	0.974	A0A087X295.pdb.gz	A0A087X295_HUMAN WD repeat domain 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
2	AFDB:Q5XFW6	0.960	0.957	0.000	1125	0.888	0.884	Q5XFW6.pdb.gz	WDR6_RAT tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Rattus norvegicus OX=10116 GN=Wdr6 PE=1 SV=2
3	AFDB:Q9USZ0	0.762	0.863	2.280E-64	984	0.202	0.230	Q9USZ0.pdb.gz	WDR6_SCHPO tRNA (34-2'-O)-methyltransferase regulator trm734 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm734 PE=3 SV=1
4	AFDB:Q86B53	0.723	0.804	9.621E-58	998	0.197	0.221	Q86B53.pdb.gz	WDR6_DROME tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Drosophila melanogaster OX=7227 GN=CG33172 PE=1 SV=2
5	PDB:6jp6A	0.739	0.824	1.392E-56	998	0.184	0.206	6jp6A.pdb.gz
6	AFDB:Q08924	0.730	0.803	3.704E-55	1013	0.181	0.200	Q08924.pdb.gz	WDR6_YEAST tRNA (34-2'-O)-methyltransferase regulator RTT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT10 PE=1 SV=1
7	AFDB:Q383K8	0.694	0.661	3.274E-34	1182	0.153	0.146	Q383K8.pdb.gz	Q383K8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2480 PE=4 SV=1
8	AFDB:C9K020	0.190	0.756	4.227E-33	271	0.211	0.871	C9K020.pdb.gz	C9K020_HUMAN WD repeat domain 6 (Fragment) OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
9	AFDB:P97499	0.247	0.132	1.786E-30	2629	0.138	0.059	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
10	AFDB:O08653	0.255	0.134	1.382E-29	2629	0.136	0.058	O08653.pdb.gz	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
11	AFDB:Q99973	0.242	0.126	5.579E-29	2627	0.153	0.065	Q99973.pdb.gz	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
12	PDB:3e0cA	0.315	0.343	1.620E-23	1011	0.101	0.112	3e0cA.pdb.gz
13	PDB:7dvq3	0.332	0.315	2.966E-23	1193	0.121	0.114	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:7uknA	0.327	0.343	9.055E-23	1059	0.112	0.118	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
15	PDB:5hxbY	0.330	0.340	1.819E-22	1080	0.115	0.119	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
16	PDB:7mqaLQ	0.222	0.293	7.009E-22	830	0.073	0.099	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6xk9Y	0.321	0.325	1.344E-21	1106	0.120	0.122	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
18	PDB:2hyeA	0.385	0.380	1.475E-21	1140	0.116	0.114	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
19	PDB:6urgA	0.225	0.215	7.513E-21	1202	0.111	0.103	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
20	PDB:7mq8LR	0.206	0.273	2.090E-20	773	0.103	0.150	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X295	0.0	2285	1151	1.000	0.974	A0A087X295_HUMAN WD repeat domain 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
2	E9PDU5	0.0	2182	1070	0.955	1.000	E9PDU5_HUMAN WD repeat domain 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
3	Q5XFW6	0.0	2037	1125	0.888	0.884	WDR6_RAT tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Rattus norvegicus OX=10116 GN=Wdr6 PE=1 SV=2
4	Q9NNW5	0.0	2281	1121	1.000	1.000	WDR6_HUMAN tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
5	C9K020	1.75e-156	468	271	0.212	0.878	C9K020_HUMAN WD repeat domain 6 (Fragment) OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
6	V9GYU1	2.72e-81	262	125	0.112	1.000	V9GYU1_HUMAN WD repeat domain 6 (Fragment) OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1
7	Q9USZ0	1.27e-36	152	984	0.219	0.249	WDR6_SCHPO tRNA (34-2'-O)-methyltransferase regulator trm734 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm734 PE=3 SV=1
8	Q08924	2.30e-28	125	1013	0.208	0.230	WDR6_YEAST tRNA (34-2'-O)-methyltransferase regulator RTT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT10 PE=1 SV=1
9	Q86B53	1.93e-25	116	998	0.202	0.226	WDR6_DROME tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Drosophila melanogaster OX=7227 GN=CG33172 PE=1 SV=2
10	Q5U3Q5	1.68e-07	58.2	897	0.040	0.050	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
11	Q9VT91	1.85e-07	58.2	942	0.046	0.055	Q9VT91_DROME Cannonball OS=Drosophila melanogaster OX=7227 GN=can PE=2 SV=1
12	O13282	4.05e-07	56.6	643	0.045	0.078	TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf5 PE=1 SV=1
13	A0A0B4KHK1	4.19e-07	56.6	597	0.049	0.092	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
14	Q9VDE3	4.21e-07	56.2	510	0.044	0.096	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
15	O44382	5.09e-07	56.2	510	0.044	0.096	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
16	A0A2R8QFQ6	9.28e-07	55.5	562	0.051	0.101	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
17	Q5SRY7	1.12e-06	55.1	542	0.052	0.107	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
18	Q8C092	1.23e-06	55.1	801	0.042	0.059	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
19	Q9UKB1	1.26e-06	55.1	542	0.052	0.107	FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1
20	Q39190	1.51e-06	54.7	479	0.032	0.075	PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana OX=3702 GN=PRL2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12124 bCoV_SUD_C	3.2e+02	12.5	Betacoronavirus SUD-C domain
2	PF12411 Choline_sulf_C	2.5e+02	12.8	Choline sulfatase enzyme C terminal
3	PF20426 NBCH_WD40	3.1	18.2	Neurobeachin beta propeller domain
4	PF13570 PQQ_3	6e+02	12.4	PQQ-like domain
5	PF00400 WD40	1.1e-15	68.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326948	0.997	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
2	9606.ENSP00000396673	0.900	pre-rRNA processing protein FTSJ3
3	9606.ENSP00000354040	0.880	Nucleolar GTP-binding protein 1
4	9606.ENSP00000361202	0.854	Insulin receptor substrate 4
5	9606.ENSP00000369292	0.836	Sterile alpha motif domain-containing protein 9
6	9606.ENSP00000446184	0.811	RRP12-like protein
7	9606.ENSP00000454836	0.811	Transducin beta-like protein 3
8	9606.ENSP00000381266	0.809	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
9	9606.ENSP00000291576	0.771	Periodic tryptophan protein 2 homolog
10	9606.ENSP00000344989	0.767	DALR anticodon-binding domain-containing protein 3
11	9606.ENSP00000482107	0.761	annotation not available
12	9606.ENSP00000466967	0.737	tRNA (guanine(26)-N(2))-dimethyltransferase
13	9606.ENSP00000385995	0.731	Thyroid adenoma-associated protein
14	9606.ENSP00000277540	0.714	Diphthine methyltransferase
15	9606.ENSP00000317992	0.705	Nucleolar complex protein 2 homolog
16	9606.ENSP00000379865	0.699	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
17	9606.ENSP00000234170	0.692	CCAAT/enhancer-binding protein zeta
18	9606.ENSP00000444156	0.688	Armadillo repeat containing 6
19	9606.ENSP00000334474	0.682	Zinc finger MIZ domain-containing protein 1
20	9606.ENSP00000485630	0.681	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.450	heterocyclic compound binding
GO:0097159	0.450	organic cyclic compound binding
GO:0003676	0.425	nucleic acid binding
GO:0003723	0.396	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0048523	0.961	negative regulation of cellular process
GO:0010506	0.945	regulation of autophagy
GO:0042127	0.891	regulation of cell population proliferation
GO:0009895	0.842	negative regulation of catabolic process
GO:0031330	0.796	negative regulation of cellular catabolic process
GO:0010507	0.779	negative regulation of autophagy
GO:0007049	0.762	cell cycle
GO:0071704	0.535	organic substance metabolic process
GO:0044238	0.500	primary metabolic process
GO:0006807	0.474	nitrogen compound metabolic process
GO:0044237	0.465	cellular metabolic process
GO:0022402	0.452	cell cycle process
GO:0043170	0.441	macromolecule metabolic process
GO:0008285	0.423	negative regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.997	membrane
GO:0005829	0.994	cytosol
GO:0032991	0.974	protein-containing complex
GO:0005634	0.939	nucleus
GO:0071944	0.919	cell periphery
GO:0005886	0.858	plasma membrane
GO:0031981	0.801	nuclear lumen
GO:0005654	0.468	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]