StarFunc result for job id Q9NNX6

User Input

>input (404 residues)
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKL
QEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV
GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQ
ELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ
NFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFS
GNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NNX6	1.000	1.000	3.635E-63	404	1.000	1.000	Q9NNX6.pdb.gz	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1
2	AFDB:Q9H2X3	0.371	0.375	1.678E-43	399	0.819	0.830	Q9H2X3.pdb.gz	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1
3	AFDB:Q8CJ91	0.383	0.470	2.353E-25	325	0.379	0.471	Q8CJ91.pdb.gz	C209B_MOUSE CD209 antigen-like protein B OS=Mus musculus OX=10090 GN=Cd209b PE=1 SV=2
4	AFDB:Q91ZW7	0.371	0.711	1.083E-20	208	0.255	0.495	Q91ZW7.pdb.gz	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
5	AFDB:Q91ZW9	0.372	0.816	1.989E-20	178	0.240	0.545	Q91ZW9.pdb.gz	C209C_MOUSE CD209 antigen-like protein C OS=Mus musculus OX=10090 GN=Cd209c PE=2 SV=1
6	AFDB:Q91ZW8	0.335	0.565	5.762E-20	237	0.255	0.435	Q91ZW8.pdb.gz	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
7	AFDB:Q91ZX1	0.344	0.573	1.058E-19	238	0.324	0.550	Q91ZX1.pdb.gz	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
8	AFDB:D3Z1H5	0.335	0.490	8.472E-17	274	0.260	0.383	D3Z1H5.pdb.gz	D3Z1H5_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
9	AFDB:Q80ZY1	0.328	0.475	9.863E-17	277	0.230	0.336	Q80ZY1.pdb.gz	Q80ZY1_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
10	AFDB:Q14FK5	0.352	0.547	4.987E-16	255	0.173	0.275	Q14FK5.pdb.gz	Q14FK5_MOUSE SIGNR7 protein OS=Mus musculus OX=10090 GN=Cd209g PE=2 SV=1
11	PDB:7wz8A	0.312	0.670	4.729E-10	180	0.116	0.261	7wz8A.pdb.gz
12	PDB:1qddA	0.281	0.749	2.860E-8	144	0.084	0.236	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:5f2qB	0.284	0.800	9.169E-8	135	0.082	0.244	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:1htnA	0.282	0.684	1.601E-7	156	0.089	0.231	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
15	PDB:1bj3B	0.232	0.700	4.637E-7	123	0.087	0.285	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
16	PDB:3bx4C	0.225	0.637	9.422E-7	134	0.072	0.216	3bx4C.pdb.gz
17	PDB:4mthA	0.270	0.730	1.214E-6	139	0.087	0.252	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
18	PDB:7jptA	0.273	0.086	1.645E-6	1327	0.092	0.028	7jptA.pdb.gz
19	PDB:7qsrA	0.273	0.086	2.014E-6	1335	0.092	0.028	7qsrA.pdb.gz
20	PDB:2kv3A	0.259	0.713	3.516E-6	131	0.092	0.282	2kv3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H2X3	0.0	654	399	0.819	0.830	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1
2	Q9NNX6	0.0	818	404	1.000	1.000	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1
3	Q8CJ91	3.84e-84	261	325	0.413	0.514	C209B_MOUSE CD209 antigen-like protein B OS=Mus musculus OX=10090 GN=Cd209b PE=1 SV=2
4	Q91ZW7	7.49e-76	236	208	0.252	0.490	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
5	Q91ZX1	3.03e-72	228	238	0.250	0.424	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
6	Q91ZW9	4.75e-72	225	178	0.250	0.567	C209C_MOUSE CD209 antigen-like protein C OS=Mus musculus OX=10090 GN=Cd209c PE=2 SV=1
7	Q91ZW8	1.38e-71	226	237	0.257	0.439	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
8	D3Z5D4	8.65e-46	158	194	0.166	0.345	D3Z5D4_MOUSE CD209g antigen OS=Mus musculus OX=10090 GN=Cd209g PE=4 SV=1
9	Q14FK5	1.72e-45	159	255	0.166	0.263	Q14FK5_MOUSE SIGNR7 protein OS=Mus musculus OX=10090 GN=Cd209g PE=2 SV=1
10	Q4KL16	1.81e-45	159	262	0.168	0.260	Q4KL16_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
11	Q7TSU6	1.85e-45	159	260	0.168	0.262	Q7TSU6_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
12	G3UVT9	1.99e-45	159	255	0.168	0.267	G3UVT9_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
13	Q80ZY1	6.90e-45	158	277	0.168	0.245	Q80ZY1_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
14	D3Z1H5	2.40e-44	157	274	0.178	0.263	D3Z1H5_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
15	Q6ZS10	7.07e-27	112	378	0.131	0.140	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
16	Q9ULY5	1.35e-26	108	219	0.156	0.288	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
17	L0N7P8	4.68e-26	106	216	0.163	0.306	L0N7P8_ONCMY CD209 antigen-like protein A OS=Oncorhynchus mykiss OX=8022 GN=cd209A PE=2 SV=1
18	Q8JZN1	2.81e-25	107	332	0.171	0.208	Q8JZN1_MOUSE Macrophage galactose N-acetyl-galactosamine specific lectin 2 OS=Mus musculus OX=10090 GN=Mgl2 PE=1 SV=1
19	Q67EQ1	2.15e-24	102	215	0.139	0.260	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
20	Q8IUN9	2.40e-24	104	316	0.198	0.253	CLC10_HUMAN C-type lectin domain family 10 member A OS=Homo sapiens OX=9606 GN=CLEC10A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	0.038	25.5	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF10046 BLOC1_2	2.5e+02	13.4	Biogenesis of lysosome-related organelles complex-1 subunit 2
3	PF17149 CHASE5	4.8	18.5	Periplasmic sensor domain found in signal transduction proteins
4	PF16566 CREPT	4.1e+02	12.5	Cell-cycle alteration and expression-elevated protein in tumour
5	PF07324 DGCR6	5.5e+02	11.6	DiGeorge syndrome critical region 6 (DGCR6) protein
6	PF16844 DIMCO_N	39	16.0	Dinitrogenase iron-molybdenum cofactor, N-terminal
7	PF06897 DUF1269	7.4e+02	11.8	Protein of unknown function (DUF1269)
8	PF09938 DUF2170	1.6e-05	36.1	Uncharacterized protein conserved in bacteria (DUF2170)
9	PF09823 DUF2357	77	14.0	Domain of unknown function (DUF2357)
10	PF10303 DUF2408	3.3e+02	13.3	Protein of unknown function (DUF2408)
11	PF10805 DUF2730	0.034	25.6	Protein of unknown function (DUF2730)
12	PF10965 DUF2767	7.3	18.1	Protein of unknown function (DUF2767)
13	PF11902 DUF3422	75	13.9	Protein of unknown function (DUF3422)
14	PF14276 DUF4363	7.6e+02	11.5	Domain of unknown function (DUF4363)
15	PF14301 DUF4376	2.9	19.6	Domain of unknown function (DUF4376)
16	PF15679 DUF4665	2.3e+02	13.8	Domain of unknown function (DUF4665)
17	PF15960 DUF4763	77	14.0	Domain of unknown function (DUF4763)
18	PF04759 DUF617	3.4	19.3	Protein of unknown function, DUF617
19	PF14463 E1-N	7.3	18.3	E1 N-terminal domain
20	PF12205 GIT1_C	94	14.7	G protein-coupled receptor kinase-interacting protein 1 C term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315477

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000160262	0.998	Intercellular adhesion molecule 3
2	9606.ENSP00000415283	0.998	Intercellular adhesion molecule 2
3	9606.ENSP00000371194	0.994	Lymphocyte-specific protein 1
4	9606.ENSP00000266041	0.989	Inter-alpha-trypsin inhibitor heavy chain H4
5	9606.ENSP00000419945	0.987	Syncytin-1
6	9606.ENSP00000225698	0.964	Complement component 1 Q subcomponent-binding protein, mitochondrial
7	9606.ENSP00000011653	0.954	T-cell surface glycoprotein CD4
8	9606.ENSP00000351602	0.939	Alpha-(1,3)-fucosyltransferase 4
9	9606.ENSP00000312158	0.938	Butyrophilin subfamily 2 member A1
10	9606.ENSP00000316228	0.935	C-type lectin domain family 4 member M
11	9606.ENSP00000441691	0.928	Integrin alpha-M
12	9606.ENSP00000161559	0.921	Carcinoembryonic antigen-related cell adhesion molecule 1
13	9606.ENSP00000407586	0.905	GTPase HRas
14	9606.ENSP00000256078	0.903	GTPase KRas
15	9606.ENSP00000380942	0.902	Rho guanine nucleotide exchange factor 12
16	9606.ENSP00000358548	0.901	GTPase NRas
17	9606.ENSP00000361207	0.898	Growth hormone-inducible transmembrane protein
18	9606.ENSP00000381958	0.882	Kinase suppressor of Ras 1
19	9606.ENSP00000260010	0.854	Toll-like receptor 2
20	9606.ENSP00000400175	0.823	Transforming protein RhoA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046790	1.000	virion binding
GO:0005515	1.000	protein binding
GO:0001618	1.000	virus receptor activity
GO:0005537	0.995	mannose binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008037	0.993	cell recognition
GO:0044419	0.992	biological process involved in interspecies interaction between organisms
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0044406	0.979	adhesion of symbiont to host
GO:0009988	0.973	cell-cell recognition
GO:0016032	0.972	viral process
GO:0044650	0.963	adhesion of symbiont to host cell
GO:0046718	0.958	viral entry into host cell
GO:0048522	0.911	positive regulation of cellular process
GO:0050865	0.908	regulation of cell activation
GO:0002694	0.890	regulation of leukocyte activation
GO:0051249	0.838	regulation of lymphocyte activation
GO:0030155	0.826	regulation of cell adhesion
GO:0002684	0.825	positive regulation of immune system process
GO:0002696	0.796	positive regulation of leukocyte activation
GO:0050863	0.794	regulation of T cell activation
GO:1903037	0.793	regulation of leukocyte cell-cell adhesion
GO:0051251	0.791	positive regulation of lymphocyte activation
GO:0045785	0.784	positive regulation of cell adhesion
GO:1903039	0.712	positive regulation of leukocyte cell-cell adhesion
GO:0046794	0.711	transport of virus
GO:0050870	0.701	positive regulation of T cell activation
GO:0098609	0.682	cell-cell adhesion
GO:0050896	0.656	response to stimulus
GO:0042127	0.595	regulation of cell population proliferation
GO:0007159	0.587	leukocyte cell-cell adhesion
GO:0008284	0.505	positive regulation of cell population proliferation
GO:0070663	0.489	regulation of leukocyte proliferation
GO:0009605	0.423	response to external stimulus
GO:0032944	0.421	regulation of mononuclear cell proliferation
GO:0050670	0.413	regulation of lymphocyte proliferation
GO:0048583	0.403	regulation of response to stimulus
GO:0070665	0.403	positive regulation of leukocyte proliferation
GO:0019222	0.383	regulation of metabolic process
GO:0042129	0.372	regulation of T cell proliferation
GO:0050671	0.370	positive regulation of lymphocyte proliferation
GO:0060255	0.369	regulation of macromolecule metabolic process
GO:0050792	0.354	regulation of viral process
GO:0002376	0.341	immune system process
GO:0006950	0.329	response to stress
GO:0051716	0.328	cellular response to stimulus
GO:0042102	0.319	positive regulation of T cell proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.986	cell surface
GO:0009897	0.735	external side of plasma membrane
GO:0043227	0.302	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]