StarFunc result for job id Q9NP31

User Input

>input (389 residues)
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVR
FSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGE
TLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPS
QLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEA
PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPP
AWRHTLPHNLSRQVLQDRGQAWLPLGPPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP31	1.000	1.000	6.074E-66	389	1.000	1.000	Q9NP31.pdb.gz	SH22A_HUMAN SH2 domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH2D2A PE=1 SV=3
2	PDB:4fl2A	0.231	0.163	9.748E-7	555	0.067	0.047	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
3	PDB:4k2rA	0.226	0.163	2.348E-6	551	0.075	0.053	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
4	PDB:1ka6A	0.234	0.784	7.739E-6	107	0.062	0.224	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
5	PDB:1griA	0.228	0.406	1.201E-5	211	0.062	0.114	1griA.pdb.gz
6	PDB:3ps5A	0.232	0.172	1.362E-5	529	0.072	0.053	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
7	AFDB:Q8MQW8	0.223	0.052	1.595E-5	1789	0.177	0.039	Q8MQW8.pdb.gz	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3
8	PDB:4gwfA	0.224	0.177	1.750E-5	497	0.075	0.058	4gwfA.pdb.gz
9	PDB:2h8hA	0.223	0.196	4.488E-5	445	0.082	0.072	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
10	PDB:1k9aB	0.225	0.199	5.770E-5	441	0.072	0.063	1k9aB.pdb.gz
11	PDB:5xzrA	0.217	0.166	6.542E-5	519	0.080	0.060	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:8dcxB	0.220	0.352	2.952E-4	236	0.062	0.102	8dcxB.pdb.gz
13	AFDB:A0A2R8PW96	0.231	0.089	3.833E-2	1048	0.082	0.031	A0A2R8PW96.pdb.gz
14	AFDB:Q9Y4B4	0.084	0.039	2.367E-1	1467	0.172	0.046	Q9Y4B4.pdb.gz	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
15	AFDB:Q9LZ56	0.087	0.086	2.684E-1	399	0.170	0.165	Q9LZ56.pdb.gz	DOF51_ARATH Dof zinc finger protein DOF5.1 OS=Arabidopsis thaliana OX=3702 GN=DOF5.1 PE=2 SV=1
16	AFDB:Q7JQU5	0.088	0.083	6.463E-1	417	0.118	0.110	Q7JQU5.pdb.gz	Q7JQU5_DROME AT09333p OS=Drosophila melanogaster OX=7227 GN=uno PE=2 SV=1
17	AFDB:P06536	0.061	0.039	7.327E-1	795	0.190	0.093	P06536.pdb.gz	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
18	AFDB:Q8NFH8	0.067	0.045	7.327E-1	660	0.165	0.097	Q8NFH8.pdb.gz	REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2 PE=1 SV=2
19	AFDB:O95243	0.088	0.064	1.068	580	0.149	0.100	O95243.pdb.gz	MBD4_HUMAN Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4 PE=1 SV=1
20	AFDB:P15207	0.061	0.033	1.137	902	0.172	0.074	P15207.pdb.gz	ANDR_RAT Androgen receptor OS=Rattus norvegicus OX=10116 GN=Ar PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NP31	0.0	789	389	1.000	1.000	SH22A_HUMAN SH2 domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH2D2A PE=1 SV=3
2	Q9QXK9	7.92e-145	417	374	0.599	0.623	SH22A_MOUSE SH2 domain-containing protein 2A OS=Mus musculus OX=10090 GN=Sh2d2a PE=1 SV=1
3	Q6VYH9	1.26e-23	102	334	0.123	0.144	HSH2D_MOUSE Hematopoietic SH2 domain-containing protein OS=Mus musculus OX=10090 GN=Hsh2d PE=2 SV=1
4	Q96JZ2	5.87e-22	97.8	352	0.121	0.134	HSH2D_HUMAN Hematopoietic SH2 domain-containing protein OS=Homo sapiens OX=9606 GN=HSH2D PE=1 SV=1
5	Q9D7V1	1.89e-10	64.3	421	0.111	0.102	SH24A_MOUSE SH2 domain-containing protein 4A OS=Mus musculus OX=10090 GN=Sh2d4a PE=1 SV=1
6	Q9H788	3.21e-09	60.8	454	0.118	0.101	SH24A_HUMAN SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A PE=1 SV=1
7	Q96IW2	2.34e-07	54.3	340	0.100	0.115	SHD_HUMAN SH2 domain-containing adapter protein D OS=Homo sapiens OX=9606 GN=SHD PE=1 SV=1
8	Q5VZ18	7.88e-07	53.1	495	0.062	0.048	SHE_HUMAN SH2 domain-containing adapter protein E OS=Homo sapiens OX=9606 GN=SHE PE=1 SV=1
9	P16885	1.72e-06	52.8	1265	0.077	0.024	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
10	Q804J6	2.32e-06	52.4	1312	0.100	0.030	Q804J6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Danio rerio OX=7955 GN=fj46f04 PE=1 SV=1
11	Q8CIH5	2.41e-06	52.0	1265	0.077	0.024	PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus OX=10090 GN=Plcg2 PE=1 SV=1
12	P24135	2.94e-06	52.0	1265	0.077	0.024	PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus OX=10116 GN=Plcg2 PE=1 SV=1
13	P29349	5.28e-06	50.8	845	0.108	0.050	CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster OX=7227 GN=csw PE=1 SV=2
14	Q9VGK8	4.49e-05	48.1	805	0.069	0.034	Q9VGK8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=3
15	Q8INJ8	5.07e-05	47.8	1052	0.069	0.026	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
16	Q7KSQ2	5.62e-05	47.8	723	0.069	0.037	Q7KSQ2_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=1
17	P08487	5.93e-05	47.8	1291	0.093	0.028	PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus OX=9913 GN=PLCG1 PE=1 SV=1
18	P19174	5.98e-05	47.8	1290	0.093	0.028	PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1
19	P10686	6.08e-05	47.8	1290	0.093	0.028	PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus OX=10116 GN=Plcg1 PE=1 SV=1
20	Q62077	6.42e-05	47.8	1302	0.093	0.028	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	3.6e-11	54.3	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003821086.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806519.1	0.982	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
2	9597.XP_008955538.1	0.893	SRC proto-oncogene, non-receptor tyrosine kinase
3	9597.XP_008951754.1	0.890	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 147 ESTs, 18 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
4	9597.XP_003825944.1	0.835	Phospholipase C gamma 1
5	9597.XP_003820933.1	0.817	Phospholipase C gamma 2
6	9597.XP_003815698.1	0.807	YES proto-oncogene 1, Src family tyrosine kinase
7	9597.XP_008955193.1	0.774	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
8	9597.XP_003828311.1	0.748	Mitogen-activated protein kinase kinase kinase 2
9	9597.XP_003818375.1	0.664	Fms related tyrosine kinase 1
10	9597.XP_003806841.1	0.658	Phosphoinositide-3-kinase regulatory subunit 1
11	9597.XP_008956987.1	0.657	Belongs to the PDGF/VEGF growth factor family.
12	9597.XP_008974002.1	0.644	Tyrosine-protein kinase Fyn isoform X1
13	9597.XP_003827610.1	0.615	Fyn related Src family tyrosine kinase
14	9597.XP_003819027.1	0.613	IL2 inducible T-cell kinase
15	9597.XP_008962002.1	0.609	Mitogen-activated protein kinase kinase kinase 3 isoform X1
16	9597.XP_003812802.2	0.605	Phosphoinositide-3-kinase regulatory subunit 3
17	9597.XP_003816057.1	0.594	TXK tyrosine kinase
18	9597.XP_008966421.1	0.584	MAP kinase-activating death domain protein
19	9597.XP_008949179.1	0.583	Pleckstrin homology domain-containing family S member 1 isoform X1
20	9597.XP_003826592.1	0.582	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.331	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.995	cellular response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.988	signaling
GO:0007165	0.980	signal transduction
GO:0007166	0.342	cell surface receptor signaling pathway
GO:0048518	0.337	positive regulation of biological process
GO:0032501	0.326	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0005634	0.565	nucleus
GO:0070013	0.499	intracellular organelle lumen
GO:0005886	0.467	plasma membrane
GO:0031981	0.332	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]