StarFunc result for job id Q9NP55

User Input

>input (256 residues)
MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLL
SGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGL
VQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDC
THSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVH
DIVNMLIHGLQFVIKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP55	1.000	1.000	1.667E-48	256	1.000	1.000	Q9NP55.pdb.gz	BPIA1_HUMAN BPI fold-containing family A member 1 OS=Homo sapiens OX=9606 GN=BPIFA1 PE=1 SV=1
2	AFDB:P97361	0.791	0.730	6.987E-35	278	0.723	0.665	P97361.pdb.gz	BPIA1_MOUSE BPI fold-containing family A member 1 OS=Mus musculus OX=10090 GN=Bpifa1 PE=1 SV=3
3	PDB:6baqF	0.757	0.912	6.597E-30	211	0.633	0.768	6baqF.pdb.gz
4	PDB:4kegA	0.612	0.299	4.811E-23	535	0.641	0.307	4kegA.pdb.gz	The Lipid Ligands of the SPLUNC1 Protein
5	AFDB:Q8TDL5	0.604	0.330	2.136E-14	484	0.223	0.118	Q8TDL5.pdb.gz	BPIB1_HUMAN BPI fold-containing family B member 1 OS=Homo sapiens OX=9606 GN=BPIFB1 PE=1 SV=1
6	AFDB:P82615	0.590	0.656	8.006E-13	228	0.238	0.268	P82615.pdb.gz	LATH_HORSE Latherin OS=Equus caballus OX=9796 GN=LATH PE=1 SV=3
7	AFDB:Q96DR5	0.489	0.501	2.230E-11	249	0.199	0.205	Q96DR5.pdb.gz	BPIA2_HUMAN BPI fold-containing family A member 2 OS=Homo sapiens OX=9606 GN=BPIFA2 PE=1 SV=2
8	PDB:3zpmA	0.590	0.703	2.799E-11	211	0.223	0.270	3zpmA.pdb.gz
9	AFDB:P07743	0.478	0.516	3.428E-10	235	0.191	0.209	P07743.pdb.gz	BPIA2_MOUSE BPI fold-containing family A member 2 OS=Mus musculus OX=10090 GN=Bpifa2 PE=1 SV=1
10	AFDB:Q63471	0.482	0.521	6.684E-9	235	0.180	0.196	Q63471.pdb.gz	BPIA2_RAT BPI fold-containing family A member 2 OS=Rattus norvegicus OX=10116 GN=Bpifa2 PE=1 SV=1
11	AFDB:P59826	0.460	0.271	1.861E-7	476	0.195	0.105	P59826.pdb.gz	BPIB3_HUMAN BPI fold-containing family B member 3 OS=Homo sapiens OX=9606 GN=BPIFB3 PE=1 SV=3
12	PDB:4m4dA	0.384	0.249	3.191E-6	448	0.121	0.069	4m4dA.pdb.gz
13	AFDB:A0A669KBJ0	0.385	0.151	3.629E-6	736	0.230	0.080	A0A669KBJ0.pdb.gz	A0A669KBJ0_HUMAN BPI fold containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=1 SV=1
14	AFDB:P17454	0.321	0.190	6.574E-6	482	0.086	0.046	P17454.pdb.gz	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
15	PDB:4ewsA	0.298	0.182	1.047E-5	472	0.086	0.047	4ewsA.pdb.gz	Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.
16	PDB:3h4zA	0.300	0.156	1.062E-4	568	0.078	0.035	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
17	PDB:5gpkB	0.149	0.162	2.229E-2	207	0.105	0.130	5gpkB.pdb.gz
18	PDB:7c3oA	0.122	0.106	8.236E-2	316	0.047	0.038	7c3oA.pdb.gz	Crystal structure of TT109 from CANDIDA ALBICANS
19	PDB:5brlA	0.134	0.149	1.044E-1	210	0.062	0.076	5brlA.pdb.gz
20	PDB:4wwuC	0.170	0.204	1.176E-1	165	0.059	0.091	4wwuC.pdb.gz	Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NP55	4.12e-174	481	256	1.000	1.000	BPIA1_HUMAN BPI fold-containing family A member 1 OS=Homo sapiens OX=9606 GN=BPIFA1 PE=1 SV=1
2	Q8K4I4	3.09e-99	292	270	0.719	0.681	BPIA1_RAT BPI fold-containing family A member 1 OS=Rattus norvegicus OX=10116 GN=Bpifa1 PE=2 SV=1
3	P97361	3.91e-98	290	278	0.730	0.673	BPIA1_MOUSE BPI fold-containing family A member 1 OS=Mus musculus OX=10090 GN=Bpifa1 PE=1 SV=3
4	P82615	1.38e-13	70.1	228	0.238	0.268	LATH_HORSE Latherin OS=Equus caballus OX=9796 GN=LATH PE=1 SV=3
5	Q8TDL5	2.69e-12	68.2	484	0.266	0.140	BPIB1_HUMAN BPI fold-containing family B member 1 OS=Homo sapiens OX=9606 GN=BPIFB1 PE=1 SV=1
6	Q96DR5	5.57e-11	63.2	249	0.180	0.185	BPIA2_HUMAN BPI fold-containing family A member 2 OS=Homo sapiens OX=9606 GN=BPIFA2 PE=1 SV=2
7	Q63471	0.003	40.4	235	0.129	0.140	BPIA2_RAT BPI fold-containing family A member 2 OS=Rattus norvegicus OX=10116 GN=Bpifa2 PE=1 SV=1
8	P07743	0.022	37.7	235	0.133	0.145	BPIA2_MOUSE BPI fold-containing family A member 2 OS=Mus musculus OX=10090 GN=Bpifa2 PE=1 SV=1
9	P59827	0.033	37.7	614	0.105	0.044	BPIB4_HUMAN BPI fold-containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=2 SV=2
10	A0A669KBJ0	0.042	37.4	736	0.105	0.037	A0A669KBJ0_HUMAN BPI fold containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=1 SV=1
11	P59826	0.065	36.6	472	0.125	0.068	BPIB3_HUMAN BPI fold-containing family B member 3 OS=Homo sapiens OX=9606 GN=BPIFB3 PE=1 SV=3
12	A3N292	3.9	31.2	1022	0.078	0.020	A3N292_ACTP2 RTX-I toxin determinant A OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=apxIA PE=3 SV=1
13	Q9SI75	3.9	31.2	783	0.117	0.038	EFGC_ARATH Elongation factor G, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPEFG PE=1 SV=1
14	P0A862	4.2	30.4	168	0.098	0.149	TPX_ECOLI Thiol peroxidase OS=Escherichia coli (strain K12) OX=83333 GN=tpx PE=1 SV=2
15	A0A0H2UR87	6.3	30.4	252	0.113	0.115	A0A0H2UR87_STRPN Threonine/serine exporter-like N-terminal domain-containing protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1731 PE=1 SV=1
16	B9F1C0	7.0	30.8	1709	0.062	0.009	SHOC1_ORYSJ Protein SHORTAGE IN CHIASMATA 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SHOC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01273 LBP_BPI_CETP	1.3e-36	137.1	LBP / BPI / CETP family, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346251

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262865	0.815	Bactericidal permeability-increasing protein
2	9606.ENSP00000379784	0.814	Cytochrome c oxidase subunit 7B2, mitochondrial
3	9606.ENSP00000170150	0.782	BPI fold containing family B member 2
4	9606.ENSP00000364632	0.782	BPI fold-containing family B member 4
5	9606.ENSP00000344929	0.763	BPI fold containing family B member 6
6	9606.ENSP00000417138	0.747	Phospholipid transfer protein
7	9606.ENSP00000364643	0.692	BPI fold-containing family B member 3
8	9606.ENSP00000217407	0.691	Lipopolysaccharide-binding protein
9	9606.ENSP00000200676	0.664	Cholesteryl ester transfer protein
10	9606.ENSP00000359600	0.639	Outer dense fiber of sperm tails 2 like
11	9606.ENSP00000319009	0.628	Transmembrane protein 45A
12	9606.ENSP00000380594	0.613	BPI fold containing family C
13	9606.ENSP00000345751	0.612	Amiloride-sensitive sodium channel subunit beta
14	9606.ENSP00000264674	0.605	MDS1 and EVI1 complex locus protein EVI1
15	9606.ENSP00000296435	0.596	Cathelicidin antimicrobial peptide
16	9606.ENSP00000253354	0.586	BPI fold-containing family B member 1
17	9606.ENSP00000278282	0.584	Uteroglobin
18	9606.ENSP00000436812	0.580	Mucin-5B
19	9606.ENSP00000470555	0.572	Kallikrein-13
20	9606.ENSP00000291009	0.570	Prolactin induced protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.415	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0006952	0.976	defense response
GO:0009607	0.975	response to biotic stimulus
GO:0048523	0.974	negative regulation of cellular process
GO:1900190	0.968	regulation of single-species biofilm formation
GO:0019731	0.965	antibacterial humoral response
GO:0048871	0.962	multicellular organismal-level homeostasis
GO:0043903	0.960	regulation of biological process involved in symbiotic interaction
GO:0045087	0.929	innate immune response
GO:0048878	0.831	chemical homeostasis
GO:0140962	0.802	multicellular organismal-level chemical homeostasis
GO:0061844	0.519	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0051049	0.448	regulation of transport
GO:0009987	0.401	cellular process
GO:0043269	0.394	regulation of monoatomic ion transport
GO:0065008	0.312	regulation of biological quality
GO:0140546	0.309	defense response to symbiont
GO:0010959	0.300	regulation of metal ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.989	extracellular space
GO:0005622	0.620	intracellular anatomical structure
GO:0043227	0.489	membrane-bounded organelle
GO:0005737	0.435	cytoplasm
GO:0043231	0.373	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]