StarFunc result for job id Q9NP58

User Input

>input (842 residues)
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPCRRRERPAGAD
SLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARGAPLPSYLLLASVLESLAGAC
GLWLLVVERSQARQRLAMGIWIKFRHSPGLLLLWTVAFAAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFVLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWR
DFGRKLRLLSGYLWPRGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIFSHLHELSLRW
HLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLTLTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI
IKYQGLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQL
YMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQA
SLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQV
GERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIV
VAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTM
ER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP58	1.000	1.000	0.000	842	1.000	1.000	Q9NP58.pdb.gz	ABCB6_HUMAN ATP-binding cassette sub-family B member 6 OS=Homo sapiens OX=9606 GN=ABCB6 PE=1 SV=1
2	AFDB:Q9DC29	0.727	0.727	3.483E-104	842	0.888	0.888	Q9DC29.pdb.gz	ABCB6_MOUSE ATP-binding cassette sub-family B member 6 OS=Mus musculus OX=10090 GN=Abcb6 PE=1 SV=1
3	AFDB:F1QCK2	0.698	0.691	3.465E-83	851	0.631	0.624	F1QCK2.pdb.gz	F1QCK2_DANRE ATP-binding cassette sub-family B member 6 OS=Danio rerio OX=7955 GN=abcb6 PE=1 SV=1
4	AFDB:Q9VF20	0.715	0.695	1.344E-73	866	0.502	0.488	Q9VF20.pdb.gz	Q9VF20_DROME ATP-binding cassette sub-family B member 6 OS=Drosophila melanogaster OX=7227 GN=Hmt-1 PE=1 SV=1
5	PDB:7d7nA	0.632	0.751	3.079E-71	704	0.821	0.982	7d7nA.pdb.gz
6	AFDB:G5EFD4	0.698	0.733	1.050E-60	801	0.417	0.438	G5EFD4.pdb.gz	HMT1_CAEEL Heavy metal tolerance factor 1 OS=Caenorhabditis elegans OX=6239 GN=hmt-1 PE=2 SV=1
7	AFDB:Q02592	0.684	0.694	1.827E-56	830	0.365	0.370	Q02592.pdb.gz	HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt1 PE=2 SV=3
8	AFDB:Q9LVM1	0.671	0.775	1.845E-51	728	0.322	0.372	Q9LVM1.pdb.gz	AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB25 PE=1 SV=1
9	AFDB:O14286	0.684	0.827	1.353E-48	693	0.281	0.342	O14286.pdb.gz	ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atm1 PE=3 SV=2
10	AFDB:Q9FUT3	0.689	0.852	2.100E-48	678	0.305	0.379	Q9FUT3.pdb.gz	AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB23 PE=1 SV=1
11	AFDB:Q9M0G9	0.685	0.845	5.289E-48	680	0.305	0.378	Q9M0G9.pdb.gz	AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB24 PE=1 SV=1
12	PDB:7n58A	0.625	0.860	4.272E-44	600	0.318	0.447	7n58A.pdb.gz
13	PDB:7vgfA	0.604	0.904	6.330E-41	550	0.284	0.435	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
14	PDB:7ph3A	0.570	0.803	1.537E-32	577	0.215	0.314	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
15	PDB:5mkkA	0.604	0.839	2.283E-32	593	0.197	0.280	5mkkA.pdb.gz
16	PDB:3qf4B	0.603	0.840	5.266E-32	588	0.207	0.296	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
17	PDB:4q4aA	0.601	0.860	3.811E-31	572	0.166	0.245	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
18	PDB:5mkkB	0.602	0.856	7.702E-31	577	0.194	0.282	5mkkB.pdb.gz
19	PDB:4m1mA	0.569	0.414	8.902E-29	1188	0.200	0.141	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
20	PDB:6tejA	0.522	0.738	5.171E-28	561	0.184	0.276	6tejA.pdb.gz	The ABC exporter IrtAB imports and reduces mycobacterial siderophores.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RXI2	0.0	982	800	0.614	0.646	A0A2R8RXI2_DANRE ATP-binding cassette sub-family B member 6 OS=Danio rerio OX=7955 GN=abcb6 PE=1 SV=1
2	F1QCK2	0.0	1019	851	0.632	0.625	F1QCK2_DANRE ATP-binding cassette sub-family B member 6 OS=Danio rerio OX=7955 GN=abcb6 PE=1 SV=1
3	G5EFD4	0.0	658	801	0.394	0.414	HMT1_CAEEL Heavy metal tolerance factor 1 OS=Caenorhabditis elegans OX=6239 GN=hmt-1 PE=2 SV=1
4	O70595	0.0	1494	836	0.876	0.883	ABCB6_RAT ATP-binding cassette sub-family B member 6 OS=Rattus norvegicus OX=10116 GN=Abcb6 PE=1 SV=1
5	Q9DC29	0.0	1499	842	0.890	0.890	ABCB6_MOUSE ATP-binding cassette sub-family B member 6 OS=Mus musculus OX=10090 GN=Abcb6 PE=1 SV=1
6	Q9NP58	0.0	1716	842	1.000	1.000	ABCB6_HUMAN ATP-binding cassette sub-family B member 6 OS=Homo sapiens OX=9606 GN=ABCB6 PE=1 SV=1
7	Q9VF20	0.0	779	866	0.501	0.487	Q9VF20_DROME ATP-binding cassette sub-family B member 6 OS=Drosophila melanogaster OX=7227 GN=Hmt-1 PE=1 SV=1
8	Q9LVM1	1.74e-175	525	728	0.328	0.379	AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB25 PE=1 SV=1
9	Q02592	2.20e-169	513	830	0.329	0.334	HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt1 PE=2 SV=3
10	Q9FUT3	7.11e-167	501	678	0.312	0.388	AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB23 PE=1 SV=1
11	Q9M0G9	7.21e-164	494	680	0.305	0.378	AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB24 PE=1 SV=1
12	O75027	3.32e-159	484	752	0.304	0.340	ABCB7_HUMAN Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7 PE=1 SV=2
13	Q61102	6.60e-158	481	752	0.308	0.344	ABCB7_MOUSE Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Mus musculus OX=10090 GN=Abcb7 PE=1 SV=3
14	Q704E8	1.88e-157	479	752	0.306	0.343	ABCB7_RAT Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Rattus norvegicus OX=10116 GN=Abcb7 PE=1 SV=1
15	H2LNR5	2.83e-153	469	746	0.300	0.339	ABCB7_ORYLA Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Oryzias latipes OX=8090 GN=abcb7 PE=1 SV=2
16	E7F6F7	8.48e-152	465	743	0.305	0.346	ABCB7_DANRE Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Danio rerio OX=7955 GN=abcb7 PE=3 SV=1
17	Q8T9W2	8.14e-150	458	697	0.293	0.354	ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcB5 PE=3 SV=1
18	J9VWU3	4.78e-146	449	732	0.292	0.336	ATM1_CRYNH Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ATM1 PE=2 SV=1
19	O14286	1.69e-144	444	693	0.287	0.349	ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atm1 PE=3 SV=2
20	G4SRS5	3.64e-143	441	704	0.281	0.337	G4SRS5_CAEEL ABC transmembrane type-1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abtm-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	26	16.7	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1.4	20.7	AAA ATPase domain
3	PF13304 AAA_21	33	15.7	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	6.1	18.6	AAA domain
5	PF13476 AAA_23	5.3e+02	12.5	AAA domain
6	PF13479 AAA_24	4.3e+02	12.0	AAA domain
7	PF13555 AAA_29	13	17.0	P-loop containing region of AAA domain
8	PF00664 ABC_membrane	1.3e-28	112.0	ABC transporter transmembrane region
9	PF00005 ABC_tran	2.6e-31	120.4	ABC transporter
10	PF01926 MMR_HSR1	3.3e+02	12.8	50S ribosome-binding GTPase
11	PF16185 MTABC_N	1.8e-75	265.2	Mitochondrial ABC-transporter N-terminal five TM region
12	PF03193 RsgA_GTPase	2.7	19.3	RsgA GTPase
13	PF13558 SbcC_Walker_B	4.5e+02	12.5	SbcC/RAD50-like, Walker B motif
14	PF00735 Septin	3.8e+02	11.7	Septin
15	PF02463 SMC_N	0.00063	30.8	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260645	0.929	ATP-binding cassette sub-family G member 5
2	9606.ENSP00000272286	0.929	ATP-binding cassette sub-family G member 8
3	9606.ENSP00000344155	0.928	ATP-binding cassette sub-family A member 2
4	9606.ENSP00000349396	0.928	ATP-binding cassette sub-family D member 4
5	9606.ENSP00000372326	0.871	Ferrochelatase, mitochondrial
6	9606.ENSP00000297504	0.808	ATP-binding cassette sub-family B member 8, mitochondrial
7	9606.ENSP00000356978	0.784	Protoporphyrinogen oxidase
8	9606.ENSP00000273158	0.783	Solute carrier family 25 member 38
9	9606.ENSP00000222388	0.777	ATP binding cassette subfamily F member 2
10	9606.ENSP00000263980	0.772	Sodium/hydrogen exchanger 1
11	9606.ENSP00000246337	0.756	Uroporphyrinogen decarboxylase
12	9606.ENSP00000440045	0.744	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
13	9606.ENSP00000264193	0.735	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
14	9606.ENSP00000445306	0.732	Sodium/potassium-transporting ATPase subunit alpha-1
15	9606.ENSP00000357787	0.727	Uroporphyrinogen-III synthase
16	9606.ENSP00000354490	0.726	Sodium/potassium-transporting ATPase subunit alpha-2
17	9606.ENSP00000218548	0.725	Potassium-transporting ATPase alpha chain 2
18	9606.ENSP00000444688	0.725	Sodium/potassium-transporting ATPase subunit alpha-3
19	9606.ENSP00000250111	0.720	Sodium/potassium-transporting ATPase subunit beta-2
20	9606.ENSP00000286371	0.720	Sodium/potassium-transporting ATPase subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.999	ABC-type transporter activity
GO:0005488	0.998	binding
GO:0005515	0.990	protein binding
GO:0097367	0.967	carbohydrate derivative binding
GO:0000166	0.965	nucleotide binding
GO:0032553	0.959	ribonucleotide binding
GO:0043168	0.958	anion binding
GO:0032555	0.952	purine ribonucleotide binding
GO:0035639	0.950	purine ribonucleoside triphosphate binding
GO:0005524	0.942	ATP binding
GO:0003824	0.812	catalytic activity
GO:0015232	0.770	heme transmembrane transporter activity
GO:0020037	0.532	heme binding
GO:0016887	0.448	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0044237	0.938	cellular metabolic process
GO:0071704	0.931	organic substance metabolic process
GO:0006807	0.825	nitrogen compound metabolic process
GO:0033013	0.805	tetrapyrrole metabolic process
GO:0051179	0.689	localization
GO:0006778	0.635	porphyrin-containing compound metabolic process
GO:0006810	0.611	transport
GO:0050896	0.506	response to stimulus
GO:0055085	0.475	transmembrane transport
GO:0065007	0.380	biological regulation
GO:0050789	0.335	regulation of biological process
GO:0042592	0.331	homeostatic process
GO:0032501	0.326	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0031090	0.998	organelle membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0098588	0.990	bounding membrane of organelle
GO:0012505	0.971	endomembrane system
GO:0005739	0.970	mitochondrion
GO:0005773	0.939	vacuole
GO:0005774	0.930	vacuolar membrane
GO:0005886	0.893	plasma membrane
GO:0031982	0.865	vesicle
GO:0098852	0.836	lytic vacuole membrane
GO:0005576	0.766	extracellular region
GO:0031410	0.757	cytoplasmic vesicle
GO:0005765	0.729	lysosomal membrane
GO:0030659	0.692	cytoplasmic vesicle membrane
GO:0043233	0.677	organelle lumen
GO:0070013	0.672	intracellular organelle lumen
GO:0005768	0.646	endosome
GO:0036019	0.644	endolysosome
GO:0010008	0.512	endosome membrane
GO:0031902	0.475	late endosome membrane
GO:0036020	0.431	endolysosome membrane
GO:0005615	0.374	extracellular space
GO:0065010	0.366	extracellular membrane-bounded organelle
GO:0070062	0.363	extracellular exosome
GO:0005634	0.349	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
RHEA:13065	0.448	ATP + H2O = ADP + H(+) + phosphate

[back to server]