StarFunc result for job id Q9NP60

User Input

>input (686 residues)
MKPPFLLALVVCSVVSTNLKMVSKRNSVDGCIDWSVDLKTYMALAGEPVRVKCALFYSYI
RTNYSTAQSTGLRLMWYKNKGDLEEPIIFSEVRMSKEEDSIWFHSAEAQDSGFYTCVLRN
STYCMKVSMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDVVWY
KECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEGKLVRRTTELKVTALLTDKPP
KPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEI
RLLKEHLGEKEVELALIFDSVVEADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGG
LGAIFLLLVLLVVIYKCYNIELMLFYRQHFGADETNDDNKEYDAYLSYTKVDQDTLDCDN
PEEEQFALEVLPDVLEKHYGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYIL
RRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSIKLLSLIKWKGSK
SSKLNSKFWKHLVYEMPIKKKEMLPRCHVLDSAEQGLFGELQPIPSIAMTSTSATLVSSQ
ADLPEFHPSDSMQIRHCCRGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLK
DTQEFHRNSSLLPLSSKELSFTSDIW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP60	1.000	1.000	0.000	686	1.000	1.000	Q9NP60.pdb.gz	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
2	AFDB:B6ZK78	0.546	0.550	8.387E-103	681	0.650	0.655	B6ZK78.pdb.gz	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
3	AFDB:P59824	0.523	0.516	3.518E-99	696	0.615	0.606	P59824.pdb.gz	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
4	AFDB:B6ZK77	0.525	0.515	2.119E-98	700	0.582	0.570	B6ZK77.pdb.gz	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
5	AFDB:Q70YG5	0.472	0.556	1.316E-51	568	0.255	0.308	Q70YG5.pdb.gz	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
6	AFDB:P13504	0.350	0.404	7.929E-47	576	0.226	0.269	P13504.pdb.gz	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
7	AFDB:Q02955	0.417	0.475	1.122E-46	576	0.224	0.267	Q02955.pdb.gz	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
8	AFDB:Q90874	0.418	0.483	1.189E-46	555	0.222	0.274	Q90874.pdb.gz	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
9	AFDB:P14778	0.340	0.398	5.210E-44	569	0.222	0.267	P14778.pdb.gz	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
10	AFDB:P14719	0.548	0.640	2.384E-42	567	0.217	0.263	P14719.pdb.gz	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
11	PDB:6dldD	0.151	0.309	7.391E-14	269	0.080	0.204	6dldD.pdb.gz
12	PDB:6dlfA	0.123	0.285	3.381E-12	236	0.079	0.229	6dlfA.pdb.gz
13	PDB:5oj2B	0.151	0.150	4.857E-11	692	0.083	0.082	5oj2B.pdb.gz
14	PDB:1e07A	0.143	0.150	6.488E-11	642	0.071	0.076	1e07A.pdb.gz
15	PDB:2rcjC	0.147	0.184	1.378E-10	523	0.074	0.098	2rcjC.pdb.gz
16	PDB:3o3uN	0.191	0.218	7.833E-10	580	0.042	0.050	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
17	PDB:1a8jL	0.167	0.408	3.191E-8	216	0.042	0.134	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
18	PDB:6enyC	0.174	0.275	5.375E-8	364	0.047	0.088	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
19	PDB:1hzhH	0.126	0.176	1.210E-7	457	0.061	0.092	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:4r2gP	0.173	0.437	1.358E-7	210	0.044	0.143	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6ZK77	0.0	834	700	0.589	0.577	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
2	B6ZK78	0.0	950	681	0.656	0.661	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
3	P59823	0.0	833	695	0.620	0.612	IRPL1_MOUSE Interleukin-1 receptor accessory protein-like 1 OS=Mus musculus OX=10090 GN=Il1rapl1 PE=1 SV=1
4	P59824	0.0	844	696	0.620	0.611	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
5	Q9NP60	0.0	1419	686	1.000	1.000	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
6	Q9NZN1	0.0	847	696	0.621	0.612	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
7	Q61730	4.14e-99	317	570	0.305	0.367	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
8	Q63621	5.29e-99	317	570	0.315	0.379	IL1AP_RAT Interleukin-1 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il1rap PE=2 SV=1
9	Q9NPH3	2.99e-97	312	570	0.309	0.372	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
10	Q70YG5	3.31e-81	270	568	0.274	0.331	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
11	O95256	1.70e-58	209	599	0.224	0.257	I18RA_HUMAN Interleukin-18 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL18RAP PE=1 SV=1
12	P14778	3.21e-57	206	569	0.229	0.276	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
13	P13504	7.78e-56	202	576	0.226	0.269	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
14	Q02955	7.78e-56	202	576	0.222	0.264	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
15	Q13478	8.19e-54	195	541	0.249	0.316	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
16	Q90874	2.73e-52	191	555	0.232	0.286	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
17	Q9Z2B1	2.97e-49	184	614	0.179	0.200	I18RA_MOUSE Interleukin-18 receptor accessory protein OS=Mus musculus OX=10090 GN=Il18rap PE=2 SV=1
18	Q01638	1.84e-48	181	556	0.204	0.252	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
19	A0A0G2K2K7	2.27e-47	179	627	0.204	0.223	A0A0G2K2K7_RAT Interleukin 18 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il18rap PE=3 SV=1
20	P14719	1.98e-44	169	567	0.206	0.249	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	7.1e-16	69.4	Immunoglobulin I-set domain
2	PF00047 ig	4.5e-12	57.3	Immunoglobulin domain
3	PF13895 Ig_2	8.5e-19	79.0	Immunoglobulin domain
4	PF13927 Ig_3	6.7e-14	63.5	Immunoglobulin domain
5	PF18452 Ig_6	1.1e-06	39.9	Immunoglobulin domain
6	PF16706 Izumo-Ig	18	16.7	Izumo-like Immunoglobulin domain
7	PF01582 TIR	8.9e-28	108.8	TIR domain
8	PF13676 TIR_2	0.00037	32.5	TIR domain
9	PF07686 V-set	1e-06	40.2	Immunoglobulin V-set domain
10	PF08204 V-set_CD47	0.068	24.6	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362217	0.764	Dachshund homolog 2
2	9606.ENSP00000268720	0.699	Copine-7
3	9606.ENSP00000262753	0.694	Protein POF1B
4	9606.ENSP00000304364	0.676	C1GALT1-specific chaperone 1
5	9606.ENSP00000376893	0.655	Interleukin-1 family member 10
6	9606.ENSP00000419542	0.651	Leucine-rich repeat-containing protein 55
7	9606.ENSP00000370593	0.647	Receptor-type tyrosine-protein phosphatase delta
8	9606.ENSP00000368402	0.614	BTB/POZ domain-containing protein KCTD4
9	9606.ENSP00000324127	0.595	PH and SEC7 domain-containing protein 3
10	9606.ENSP00000365351	0.585	Integrin subunit beta like 1
11	9606.ENSP00000280357	0.573	Interleukin-18
12	9606.ENSP00000376896	0.508	Interleukin-36 receptor antagonist protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	0.999	cytokine receptor activity
GO:0005515	0.996	protein binding
GO:0005102	0.798	signaling receptor binding
GO:0004908	0.791	interleukin-1 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.960	cellular process
GO:0051128	0.926	regulation of cellular component organization
GO:0050803	0.917	regulation of synapse structure or activity
GO:0032502	0.907	developmental process
GO:0032501	0.904	multicellular organismal process
GO:0048856	0.904	anatomical structure development
GO:0044087	0.903	regulation of cellular component biogenesis
GO:1901888	0.881	regulation of cell junction assembly
GO:0050807	0.863	regulation of synapse organization
GO:0099174	0.840	regulation of presynapse organization
GO:0051963	0.837	regulation of synapse assembly
GO:0007275	0.811	multicellular organism development
GO:0048731	0.708	system development
GO:1905606	0.687	regulation of presynapse assembly
GO:0007399	0.654	nervous system development
GO:0050896	0.593	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.977	plasma membrane
GO:0030054	0.879	cell junction
GO:0045202	0.727	synapse
GO:0043226	0.723	organelle
GO:0098978	0.592	glutamatergic synapse
GO:0005622	0.570	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]