StarFunc result for job id Q9NP61

User Input

>input (516 residues)
MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSL
ASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPV
ETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANT
CFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNV
DSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEP
VELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLP
NAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4U0	0.315	0.315	8.768E-65	516	1.000	1.000	A0A024R4U0.pdb.gz
2	AFDB:Q9D8S3	0.293	0.290	2.463E-60	523	0.814	0.803	Q9D8S3.pdb.gz	ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Arfgap3 PE=1 SV=2
3	AFDB:A8JNX0	0.331	0.311	9.947E-33	553	0.422	0.394	A8JNX0.pdb.gz	A8JNX0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform H OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=2
4	AFDB:M9PG88	0.297	0.298	5.203E-30	514	0.407	0.409	M9PG88.pdb.gz	M9PG88_DROME ADP-ribosylation factor GTPase activating protein 3, isoform F OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
5	AFDB:E9PN48	0.281	0.560	9.032E-25	252	0.302	0.619	E9PN48.pdb.gz	E9PN48_HUMAN ADP ribosylation factor GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=2
6	AFDB:J9VMB5	0.264	0.285	1.436E-20	477	0.295	0.319	J9VMB5.pdb.gz	J9VMB5_CRYNH ADP-ribosylation factor GTPase-activating protein 2/3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_05314 PE=4 SV=1
7	AFDB:O82171	0.240	0.308	2.139E-20	395	0.283	0.370	O82171.pdb.gz	AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana OX=3702 GN=AGD10 PE=2 SV=1
8	AFDB:Q9FIQ0	0.240	0.305	7.714E-19	402	0.250	0.321	Q9FIQ0.pdb.gz	AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana OX=3702 GN=AGD9 PE=1 SV=1
9	AFDB:Q10367	0.256	0.273	1.487E-17	483	0.250	0.267	Q10367.pdb.gz	GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glo3 PE=3 SV=2
10	AFDB:P38682	0.265	0.277	5.829E-17	493	0.234	0.245	P38682.pdb.gz	GLO3_YEAST ADP-ribosylation factor GTPase-activating protein GLO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO3 PE=1 SV=1
11	PDB:3o47A	0.205	0.362	3.694E-12	289	0.105	0.187	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
12	PDB:3ljuX	0.176	0.236	5.723E-7	373	0.068	0.094	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:3lvqE	0.179	0.218	6.440E-5	420	0.085	0.105	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
14	PDB:1u5kA	0.074	0.140	2.929E-1	242	0.041	0.087	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
15	PDB:2pv0B	0.053	0.076	2.853	347	0.012	0.017	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
16	PDB:2rvqD	0.057	0.180	4.497	129	0.027	0.109	2rvqD.pdb.gz
17	PDB:2rsvA	0.072	0.086	5.647	403	0.035	0.045	2rsvA.pdb.gz
18	PDB:1b67A	0.056	0.279	7.091	68	0.012	0.088	1b67A.pdb.gz
19	PDB:3tpoA	0.070	0.078	7.506	438	0.039	0.046	3tpoA.pdb.gz
20	PDB:6tdaK	0.056	0.104	7.506	235	0.014	0.030	6tdaK.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D8S3	0.0	846	523	0.814	0.803	ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Arfgap3 PE=1 SV=2
2	Q9NP61	0.0	1070	516	1.000	1.000	ARFG3_HUMAN ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1
3	Q8N6H7	5.32e-171	494	521	0.564	0.559	ARFG2_HUMAN ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1
4	E9PN48	3.00e-168	488	535	0.564	0.544	E9PN48_HUMAN ADP ribosylation factor GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=2
5	E9PIY6	1.85e-121	361	327	0.370	0.584	E9PIY6_HUMAN ADP ribosylation factor GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1
6	Q9VNS2	2.00e-106	330	552	0.434	0.406	Q9VNS2_DROME ADP-ribosylation factor GTPase activating protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
7	A8JNX0	2.90e-106	330	553	0.434	0.405	A8JNX0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform H OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=2
8	M9PIL3	5.43e-106	329	549	0.434	0.408	M9PIL3_DROME ADP-ribosylation factor GTPase activating protein 3, isoform G OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
9	M9PGG0	6.19e-99	310	513	0.415	0.417	M9PGG0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform E OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
10	M9PG88	9.07e-99	309	514	0.415	0.416	M9PG88_DROME ADP-ribosylation factor GTPase activating protein 3, isoform F OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
11	O82171	3.68e-41	154	395	0.190	0.248	AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana OX=3702 GN=AGD10 PE=2 SV=1
12	J9VMB5	4.46e-39	150	477	0.136	0.147	J9VMB5_CRYNH ADP-ribosylation factor GTPase-activating protein 2/3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_05314 PE=4 SV=1
13	Q9FIQ0	4.66e-39	149	402	0.190	0.244	AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana OX=3702 GN=AGD9 PE=1 SV=1
14	Q10367	2.74e-37	145	483	0.122	0.130	GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glo3 PE=3 SV=2
15	Q9M354	2.87e-33	134	459	0.124	0.139	AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana OX=3702 GN=AGD6 PE=1 SV=1
16	O80925	8.89e-33	132	456	0.112	0.127	AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana OX=3702 GN=AGD7 PE=1 SV=1
17	Q9EPJ9	5.59e-28	117	414	0.122	0.152	ARFG1_MOUSE ADP-ribosylation factor GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arfgap1 PE=1 SV=2
18	Q62848	1.04e-27	117	415	0.116	0.145	ARFG1_RAT ADP-ribosylation factor GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgap1 PE=1 SV=1
19	Q8N6T3	1.11e-26	114	406	0.118	0.150	ARFG1_HUMAN ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2
20	Q54DK9	1.88e-26	114	522	0.091	0.090	Q54DK9_DICDI Arf GTPase activating protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292148 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	1.5e-27	107.4	Putative GTPase activating protein for Arf
2	PF12329 TMF_DNA_bd	1.1e+02	14.3	TATA element modulatory factor 1 DNA binding
3	PF01258 zf-dskA_traR	5.9e+02	11.8	Prokaryotic dksA/traR C4-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263245

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.995	ADP-ribosylation factor 1
2	9606.ENSP00000314615	0.994	ADP-ribosylation factor GTPase-activating protein 1
3	9606.ENSP00000357048	0.973	Coatomer subunit alpha
4	9606.ENSP00000386918	0.967	ER lumen protein-retaining receptor 3
5	9606.ENSP00000329471	0.962	ER lumen protein-retaining receptor 1
6	9606.ENSP00000249923	0.935	Coatomer subunit beta
7	9606.ENSP00000258739	0.934	ER lumen protein-retaining receptor 2
8	9606.ENSP00000242285	0.924	Clathrin light chain A
9	9606.ENSP00000309415	0.921	Clathrin light chain B
10	9606.ENSP00000400175	0.916	Transforming protein RhoA
11	9606.ENSP00000407586	0.915	GTPase HRas
12	9606.ENSP00000348461	0.911	Ras-related C3 botulinum toxin substrate 1
13	9606.ENSP00000434442	0.904	ADP-ribosylation factor GTPase-activating protein 2
14	9606.ENSP00000325002	0.892	Coatomer subunit gamma-1
15	9606.ENSP00000306010	0.889	ADP-ribosylation factor 4
16	9606.ENSP00000329419	0.880	Coatomer subunit beta
17	9606.ENSP00000359000	0.879	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
18	9606.ENSP00000000233	0.877	ADP-ribosylation factor 5
19	9606.ENSP00000402346	0.874	Coatomer subunit gamma-2
20	9606.ENSP00000256682	0.849	ADP-ribosylation factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140677	0.999	molecular function activator activity
GO:0030695	0.999	GTPase regulator activity
GO:0005096	0.992	GTPase activator activity
GO:0003824	0.551	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0051234	0.985	establishment of localization
GO:0006810	0.984	transport
GO:0051641	0.935	cellular localization
GO:0032940	0.808	secretion by cell
GO:0009306	0.789	protein secretion
GO:0016192	0.350	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005794	0.996	Golgi apparatus
GO:0016020	0.993	membrane
GO:0031090	0.482	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]