StarFunc result for job id Q9NP71

User Input

>input (852 residues)
MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSD
SLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMRE
YHKWRIYYKKRLRKPSREDDLLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGR
QLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDIS
DFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARN
SCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAP
PTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPAAFPPTPQSVPSPAPTPFPIELLPLGYS
EPAFGPCFSMPRGKPPAPSPRGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQA
LEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAER
LSPPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRITHISAEQK
RRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAGLQEEAQQLRDE
IEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFE
SFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQAT
RAVTEGTLGKPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP71	1.000	1.000	0.000	852	1.000	1.000	Q9NP71.pdb.gz	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
2	AFDB:Q8VIP2	0.280	0.276	3.846E-88	865	0.827	0.815	Q8VIP2.pdb.gz	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
3	AFDB:A0A0C4DG26	0.167	0.193	5.528E-78	721	0.840	0.993	A0A0C4DG26.pdb.gz	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
4	AFDB:Q9HAP2	0.129	0.120	1.931E-41	919	0.426	0.395	Q9HAP2.pdb.gz	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
5	AFDB:Q2VPU4	0.168	0.158	3.168E-41	917	0.431	0.400	Q2VPU4.pdb.gz	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
6	AFDB:Q9BKE5	0.129	0.104	9.475E-29	1062	0.270	0.217	Q9BKE5.pdb.gz	Q9BKE5_DROME Mlx interactor beta OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
7	AFDB:P41846	0.115	0.099	1.747E-21	1009	0.281	0.237	P41846.pdb.gz	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
8	AFDB:Q59DP0	0.045	0.053	2.160E-3	680	0.108	0.135	Q59DP0.pdb.gz	Q59DP0_DROME Shaven, isoform D OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=1
9	AFDB:Q7SZL5	0.061	0.043	4.418E-3	1338	0.157	0.100	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
10	AFDB:Q0WR66	0.057	0.060	5.211E-3	793	0.162	0.174	Q0WR66.pdb.gz	ASY3_ARATH Meiosis-specific protein ASY3 OS=Arabidopsis thaliana OX=3702 GN=ASY3 PE=1 SV=1
11	PDB:2b5uA	0.051	0.079	2.083	470	0.027	0.049	2b5uA.pdb.gz
12	PDB:6iczL	0.046	0.075	2.201	454	0.035	0.066	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:6id0L	0.054	0.076	2.457	475	0.038	0.067	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:4o9yA	0.053	0.026	2.743	2490	0.049	0.017	4o9yA.pdb.gz
15	PDB:7nacm	0.044	0.053	3.062	666	0.053	0.068	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:6tcaA	0.045	0.080	3.419	345	0.025	0.061	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
17	PDB:4f0tB	0.046	0.129	3.612	172	0.027	0.134	4f0tB.pdb.gz
18	PDB:7aoaD	0.047	0.092	3.816	343	0.035	0.087	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
19	PDB:7lbmd	0.048	0.103	4.502	275	0.032	0.098	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
20	PDB:7v2wJ	0.039	0.119	5.310	236	0.032	0.114	7v2wJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG26	0.0	1061	721	0.638	0.755	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
2	Q8VIP2	0.0	1294	865	0.833	0.821	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
3	Q99MZ3	0.0	1293	864	0.823	0.811	MLXPL_MOUSE Carbohydrate-responsive element-binding protein OS=Mus musculus OX=10090 GN=Mlxipl PE=1 SV=1
4	Q9NP71	0.0	1696	852	1.000	1.000	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
5	Q2VPU4	2.22e-174	529	917	0.432	0.401	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
6	Q9HAP2	5.78e-80	279	919	0.157	0.146	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
7	Q9BKE4	4.49e-48	186	836	0.102	0.104	Q9BKE4_DROME Mlx interactor gamma OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
8	Q8INT6	1.05e-47	185	925	0.102	0.094	Q8INT6_DROME FI20159p1 OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
9	Q9VID4	3.24e-47	184	1119	0.102	0.078	Q9VID4_DROME LD38259p OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=2
10	Q9BKE5	4.58e-47	184	1062	0.102	0.082	Q9BKE5_DROME Mlx interactor beta OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
11	P41846	4.54e-31	133	1009	0.116	0.098	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
12	Q9UH92	7.98e-18	87.4	298	0.072	0.205	MLX_HUMAN Max-like protein X OS=Homo sapiens OX=9606 GN=MLX PE=1 SV=2
13	O08609	1.13e-17	86.7	298	0.072	0.205	MLX_MOUSE Max-like protein X OS=Mus musculus OX=10090 GN=Mlx PE=1 SV=1
14	Q9VB47	1.00e-12	71.2	254	0.065	0.217	Q9VB47_DROME Bigmax OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
15	Q9GQP6	2.69e-12	70.1	254	0.066	0.220	Q9GQP6_DROME BHLHZip transcription factor BIGMAX OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
16	A0A2R8VI80	2.36e-06	51.6	214	0.038	0.150	A0A2R8VI80_MOUSE Transcription factor AP4 (Fragment) OS=Mus musculus OX=10090 GN=Tfap4 PE=1 SV=1
17	Q01664	5.94e-05	48.5	338	0.038	0.095	TFAP4_HUMAN Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2
18	Q9JIZ5	6.49e-05	48.5	338	0.038	0.095	Q9JIZ5_MOUSE Activator protein 4 OS=Mus musculus OX=10090 GN=Tfap4 PE=1 SV=1
19	Q8BWA4	6.57e-05	48.5	334	0.038	0.096	Q8BWA4_MOUSE BHLH domain-containing protein OS=Mus musculus OX=10090 GN=Tfap4 PE=2 SV=1
20	A6XLD8	0.083	39.3	1105	0.027	0.021	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	1.5e+02	12.8	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF00010 HLH	9.2e-09	46.5	Helix-loop-helix DNA-binding domain
3	PF16331 TolA_bind_tri	5.8e+02	12.0	TolA binding protein trimerisation
4	PF06005 ZapB	4.1e+02	12.9	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246912	0.991	Max-like protein X
2	9606.ENSP00000253792	0.964	ATP-citrate synthase
3	9606.ENSP00000339933	0.961	Pyruvate kinase PKLR
4	9606.ENSP00000389814	0.949	Adiponectin
5	9606.ENSP00000349616	0.923	Adiponectin receptor protein 2
6	9606.ENSP00000360290	0.920	5'-AMP-activated protein kinase catalytic subunit alpha-2
7	9606.ENSP00000361930	0.920	14-3-3 protein beta/alpha
8	9606.ENSP00000229328	0.919	5'-AMP-activated protein kinase subunit beta-1
9	9606.ENSP00000346148	0.917	5'-AMP-activated protein kinase catalytic subunit alpha-1
10	9606.ENSP00000341785	0.913	Adiponectin receptor protein 1
11	9606.ENSP00000418447	0.912	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
12	9606.ENSP00000254101	0.911	5'-AMP-activated protein kinase subunit beta-2
13	9606.ENSP00000221138	0.910	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
14	9606.ENSP00000287878	0.909	5'-AMP-activated protein kinase subunit gamma-2
15	9606.ENSP00000323867	0.909	5'-AMP-activated protein kinase subunit gamma-1
16	9606.ENSP00000265717	0.906	cAMP-dependent protein kinase type II-beta regulatory subunit
17	9606.ENSP00000359719	0.903	cAMP-dependent protein kinase catalytic subunit beta
18	9606.ENSP00000265563	0.902	cAMP-dependent protein kinase type II-alpha regulatory subunit
19	9606.ENSP00000376475	0.902	cAMP-dependent protein kinase type I-alpha regulatory subunit
20	9606.ENSP00000385749	0.902	cAMP-dependent protein kinase type I-beta regulatory subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.999	transcription regulator activity
GO:0046983	0.997	protein dimerization activity
GO:0046982	0.975	protein heterodimerization activity
GO:0035538	0.950	carbohydrate response element binding
GO:0003700	0.941	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0009987	0.982	cellular process
GO:0062012	0.981	regulation of small molecule metabolic process
GO:0009894	0.981	regulation of catabolic process
GO:0006109	0.980	regulation of carbohydrate metabolic process
GO:0043467	0.978	regulation of generation of precursor metabolites and energy
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0043470	0.955	regulation of carbohydrate catabolic process
GO:0019220	0.955	regulation of phosphate metabolic process
GO:1903578	0.953	regulation of ATP metabolic process
GO:0048518	0.944	positive regulation of biological process
GO:0009889	0.941	regulation of biosynthetic process
GO:0051252	0.938	regulation of RNA metabolic process
GO:0031326	0.930	regulation of cellular biosynthetic process
GO:0006110	0.928	regulation of glycolytic process
GO:0048522	0.917	positive regulation of cellular process
GO:0062013	0.915	positive regulation of small molecule metabolic process
GO:0048519	0.911	negative regulation of biological process
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0048523	0.890	negative regulation of cellular process
GO:0051173	0.884	positive regulation of nitrogen compound metabolic process
GO:0009896	0.880	positive regulation of catabolic process
GO:0019216	0.873	regulation of lipid metabolic process
GO:0045935	0.868	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.853	positive regulation of biosynthetic process
GO:0009892	0.845	negative regulation of metabolic process
GO:0031324	0.818	negative regulation of cellular metabolic process
GO:0031329	0.767	regulation of cellular catabolic process
GO:0050896	0.761	response to stimulus
GO:0045834	0.755	positive regulation of lipid metabolic process
GO:0046890	0.724	regulation of lipid biosynthetic process
GO:0010468	0.704	regulation of gene expression
GO:0045913	0.666	positive regulation of carbohydrate metabolic process
GO:0045937	0.657	positive regulation of phosphate metabolic process
GO:0051716	0.644	cellular response to stimulus
GO:0045981	0.635	positive regulation of nucleotide metabolic process
GO:0010605	0.606	negative regulation of macromolecule metabolic process
GO:1900544	0.604	positive regulation of purine nucleotide metabolic process
GO:1903580	0.586	positive regulation of ATP metabolic process
GO:0031331	0.535	positive regulation of cellular catabolic process
GO:0010556	0.496	regulation of macromolecule biosynthetic process
GO:0042592	0.456	homeostatic process
GO:0010604	0.452	positive regulation of macromolecule metabolic process
GO:0042221	0.447	response to chemical
GO:0006355	0.436	regulation of DNA-templated transcription
GO:0007154	0.433	cell communication
GO:0023052	0.409	signaling
GO:0008152	0.402	metabolic process
GO:0010033	0.393	response to organic substance
GO:0007165	0.382	signal transduction
GO:0048878	0.375	chemical homeostasis
GO:0051246	0.374	regulation of protein metabolic process
GO:0051172	0.364	negative regulation of nitrogen compound metabolic process
GO:0006357	0.343	regulation of transcription by RNA polymerase II
GO:0032501	0.337	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.403	membrane
GO:0032991	0.395	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]