StarFunc result for job id Q9NP73

User Input

>input (1137 residues)
MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDV
YRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEG
HLFYCTCRVLTCPGQAKSIASAPGKCQDSAALTSTAFSGLDFGLLSGYLHKQALVTATHP
TCTLLFPSCHAFFPLPLTPTLYKMHKGWKNYCSQKSLNEASMDEYLGSLGLFRKLTAKDA
SCLFRAISEQLFCSQVHHLEIRKACVSYMRENQQTFESYVEGSFEKYLERLGDPKESAGQ
LEIRALSLIYNRDFILYRFPGKPPTYVTDNGYEDKILLCYSSSGHYDSVYSKQFQSSAAV
CQAVLYEILYKDVFVVDEEELKTAIKLFRSGSKKNRNNAVTGSEDAHTDYKSSNQNRMEE
WGACYNAENIPEGYNKGTEETKSPENPSKMPFPYKVLKALDPEIYRNVEFDVWLDSRKEL
QKSDYMEYAGRQYYLGDKCQVCLESEGRYYNAHIQEVGNENNSVTVFIEELAEKHVVPLA
NLKPVTQVMSVPAWNAMPSRKGRGYQKMPGGYVPEIVISEMDIKQQKKMFKKIRGKEVYM
TMAYGKGDPLLPPRLQHSMHYGHDPPMHYSQTAGNVMSNEHFHPQHPSPRQGRGYGMPRN
SSRFINRHNMPGPKVDFYPGPGKRCCQSYDNFSYRSRSFRRSHRQMSCVNKESQYGFTPG
NGQMPRGLEETITFYEVEEGDETAYPTLPNHGGPSTMVPATSGYCVGRRGHSSGKQTLNL
EEGNGQSENGRYHEEYLYRAEPDYETSGVYSTTASTANLSLQDRKSCSMSPQDTVTSYNY
PQKMMGNIAAVAASCANNVPAPVLSNGAAANQAISTTSVSSQNAIQPLFVSPPTHGRPVI
ASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPP
LPPPPYSCDPSGSDLPQDTKVLQYYFNLGLQCYYHSYWHSMVYVPQMQQQLHVENYPVYT
EPPLVDQTVPQCYSEVRREDGIQAEASANDTFPNADSSSVPHGAVYYPVMSDPYGQPPLP
GFDSCLPVVPDYSCVPPWHPVGTAYGGSSQIHGAINPGPIGCIAPSPPASHYVPQGM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D8C3	0.304	0.297	0.000	1166	0.663	0.647	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
2	AFDB:Q9NP73	0.999	0.999	0.000	1137	1.000	1.000	Q9NP73.pdb.gz	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
3	AFDB:F1QHE7	0.220	0.187	1.054E-34	1358	0.237	0.199	F1QHE7.pdb.gz
4	PDB:4ambB	0.096	0.272	2.372E-6	373	0.023	0.070	4ambB.pdb.gz
5	PDB:2jzcA	0.100	0.483	4.962E-6	201	0.040	0.224	2jzcA.pdb.gz
6	PDB:1pn3A	0.093	0.258	1.495E-4	391	0.024	0.069	1pn3A.pdb.gz	Structure of the Tdp-Epi-Vancosaminyltransferase Gtfa from the Chloroeremomycin Biosynthetic Pathway.
7	PDB:1rrvA	0.086	0.230	5.836E-4	401	0.021	0.060	1rrvA.pdb.gz	Crystal Structure of Vancosaminyltransferase Gtfd from the Vancomycin Biosynthetic Pathway: Interactions with Acceptor and Nucleotide Ligands
8	AFDB:A0A0B4K620	0.044	0.040	7.636E-4	1344	0.118	0.100	A0A0B4K620.pdb.gz	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
9	PDB:5nv8A	0.075	0.247	9.189E-4	303	0.013	0.050	5nv8A.pdb.gz	Structural Basis for EarP-Mediated Arginine Glycosylation of Translation Elongation Factor EF-P.
10	PDB:4dhjA	0.083	0.341	1.029E-3	248	0.026	0.121	4dhjA.pdb.gz
11	PDB:4ddgA	0.083	0.223	1.220E-3	399	0.026	0.075	4ddgA.pdb.gz
12	PDB:4fjvA	0.080	0.369	1.220E-3	231	0.011	0.056	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
13	PDB:6lf6A	0.086	0.201	1.292E-3	457	0.022	0.055	6lf6A.pdb.gz	Dissection of the general two-step di- C -glycosylation pathway for the biosynthesis of (iso)schaftosides in higher plants.
14	PDB:4an4D	0.087	0.267	1.447E-3	348	0.025	0.080	4an4D.pdb.gz
15	AFDB:F1R405	0.043	0.036	2.004E-3	1573	0.146	0.106	F1R405.pdb.gz	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
16	AFDB:F1Q4W7	0.054	0.043	3.741E-3	1454	0.164	0.129	F1Q4W7.pdb.gz	F1Q4W7_DANRE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Danio rerio OX=7955 GN=dot1l PE=1 SV=2
17	AFDB:A0A024R657	0.046	0.042	7.393E-3	1257	0.071	0.064	A0A024R657.pdb.gz
18	AFDB:F8VPQ2	0.042	0.038	7.393E-3	1261	0.080	0.072	F8VPQ2.pdb.gz	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
19	AFDB:A4FU49	0.054	0.075	1.164E-2	640	0.077	0.138	A4FU49.pdb.gz	SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens OX=9606 GN=SH3D21 PE=2 SV=2
20	AFDB:O00512	0.046	0.039	1.164E-2	1426	0.151	0.121	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IPL2	0.0	578	854	0.339	0.451	A0A0R4IPL2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=2
2	E9QIU2	0.0	598	889	0.346	0.442	E9QIU2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=1
3	Q49HH8	0.0	564	859	0.339	0.448	Q49HH8_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=2 SV=1
4	Q9D8C3	0.0	1226	1166	0.538	0.525	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
5	Q9NP73	0.0	2357	1137	1.000	1.000	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
6	B2RRE7	1.75e-86	306	1107	0.222	0.228	OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus OX=10090 GN=Otud4 PE=1 SV=1
7	Q01804	1.74e-82	294	1114	0.164	0.167	OTUD4_HUMAN OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4
8	P10383	3.58e-48	188	853	0.105	0.140	OTU_DROME Protein ovarian tumor locus OS=Drosophila melanogaster OX=7227 GN=otu PE=2 SV=2
9	O14190	2.59e-23	99.8	162	0.049	0.346	ALG13_SCHPO UDP-N-acetylglucosamine transferase subunit alg13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg13 PE=3 SV=1
10	Q54G73	6.20e-21	99.0	398	0.052	0.148	Q54G73_DICDI Glycosyl transferase family 28 C-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=ugt1 PE=3 SV=1
11	P53178	1.03e-12	70.5	202	0.044	0.248	ALG13_YEAST UDP-N-acetylglucosamine transferase subunit ALG13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG13 PE=1 SV=1
12	Q3U2S4	1.40e-11	70.9	566	0.033	0.067	OTUD5_MOUSE OTU domain-containing protein 5 OS=Mus musculus OX=10090 GN=Otud5 PE=1 SV=2
13	B1AZ99	2.00e-10	66.6	396	0.050	0.144	OTUD3_MOUSE OTU domain-containing protein 3 OS=Mus musculus OX=10090 GN=Otud3 PE=1 SV=1
14	Q96G74	3.53e-10	66.6	571	0.033	0.065	OTUD5_HUMAN OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1
15	Q9XIP2	8.21e-10	65.1	505	0.032	0.071	OTU6_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 6 OS=Arabidopsis thaliana OX=3702 GN=OTU6 PE=1 SV=2
16	Q5T2D3	2.99e-08	59.7	398	0.040	0.113	OTUD3_HUMAN OTU domain-containing protein 3 OS=Homo sapiens OX=9606 GN=OTUD3 PE=1 SV=1
17	Q95S49	6.83e-08	58.9	568	0.027	0.055	Q95S49_DROME GM08907p OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=1
18	E1JIE7	6.89e-08	58.9	568	0.027	0.055	E1JIE7_DROME Deubiquitinating enzyme A, isoform G OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=1
19	Q9VTK7	7.96e-08	58.9	659	0.027	0.047	Q9VTK7_DROME Deubiquitinating enzyme A, isoform E OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2
20	Q8IQF9	1.37e-07	57.8	499	0.027	0.062	Q8IQF9_DROME AT23158p OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04101 Glyco_tran_28_C	1.5e-23	95.1	Glycosyltransferase family 28 C-terminal domain
2	PF02338 OTU	6.8e-09	47.7	OTU-like cysteine protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378260

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359224	0.999	UDP-N-acetylglucosamine transferase subunit ALG14 homolog
2	9606.ENSP00000386597	0.999	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
3	9606.ENSP00000262374	0.983	Chitobiosyldiphosphodolichol beta-mannosyltransferase
4	9606.ENSP00000430236	0.883	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
5	9606.ENSP00000360149	0.830	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
6	9606.ENSP00000333813	0.824	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
7	9606.ENSP00000361036	0.819	LHFPL tetraspan subfamily member 1
8	9606.ENSP00000299626	0.786	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
9	9606.ENSP00000380793	0.785	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
10	9606.ENSP00000482396	0.766	Alpha-1,2-mannosyltransferase ALG9
11	9606.ENSP00000482437	0.766	Mannosyltransferase
12	9606.ENSP00000239891	0.752	ALG5, dolichyl-phosphate beta-glucosyltransferase
13	9606.ENSP00000266483	0.747	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
14	9606.ENSP00000310120	0.746	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
15	9606.ENSP00000360644	0.711	Dolichol-phosphate mannosyltransferase subunit 1
16	9606.ENSP00000340590	0.682	Retrotransposon Gag-like protein 4
17	9606.ENSP00000457788	0.668	Alpha-mannosidase 2C1
18	9606.ENSP00000296292	0.642	Protein RFT1 homolog
19	9606.ENSP00000326813	0.638	Ubiquitin thioesterase OTU1
20	9606.ENSP00000374552	0.634	E3 ubiquitin-protein ligase RNF216

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.875	catalytic activity
GO:0016787	0.678	hydrolase activity
GO:0016740	0.515	transferase activity
GO:0140096	0.375	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048583	0.872	regulation of response to stimulus
GO:0050794	0.828	regulation of cellular process
GO:0023051	0.813	regulation of signaling
GO:0010646	0.813	regulation of cell communication
GO:0009966	0.797	regulation of signal transduction
GO:0008152	0.790	metabolic process
GO:0071704	0.778	organic substance metabolic process
GO:0044238	0.758	primary metabolic process
GO:0006807	0.727	nitrogen compound metabolic process
GO:0048519	0.601	negative regulation of biological process
GO:0048523	0.588	negative regulation of cellular process
GO:0043170	0.579	macromolecule metabolic process
GO:1901564	0.510	organonitrogen compound metabolic process
GO:0019538	0.503	protein metabolic process
GO:0043412	0.482	macromolecule modification
GO:0009987	0.464	cellular process
GO:0036211	0.425	protein modification process
GO:0009968	0.415	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.997	endomembrane system
GO:0031090	0.991	organelle membrane
GO:0005783	0.987	endoplasmic reticulum
GO:0005789	0.980	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.678	Hydrolases.
EC:2.-.-.-	0.515	Transferases.

[back to server]