StarFunc result for job id Q9NP77

User Input

>input (194 residues)
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTT
YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVV
EDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFE
EKSGRTFLHTVCFY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP77	1.000	1.000	4.562E-43	194	1.000	1.000	Q9NP77.pdb.gz	SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens OX=9606 GN=SSU72 PE=1 SV=1
2	PDB:4h3hE	0.985	0.995	2.571E-39	192	0.985	0.995	4h3hE.pdb.gz	An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
3	AFDB:Q9VWE4	0.977	0.972	2.069E-32	195	0.603	0.600	Q9VWE4.pdb.gz	Q9VWE4_DROME RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Drosophila melanogaster OX=7227 GN=Ssu72 PE=1 SV=1
4	PDB:3p9yA	0.980	0.960	3.378E-30	198	0.593	0.581	3p9yA.pdb.gz	cis-Proline-mediated Ser(P)5 Dephosphorylation by the RNA Polymerase II C-terminal Domain Phosphatase Ssu72.
5	AFDB:Q22453	0.966	0.951	6.961E-30	197	0.567	0.558	Q22453.pdb.gz	SSU72_CAEEL RNA polymerase II subunit A C-terminal domain phosphatase ssup-72 OS=Caenorhabditis elegans OX=6239 GN=ssup-72 PE=1 SV=4
6	AFDB:Q9C9T0	0.966	0.971	2.798E-29	193	0.495	0.497	Q9C9T0.pdb.gz	Q9C9T0_ARATH RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Arabidopsis thaliana OX=3702 GN=SSU72 PE=1 SV=1
7	AFDB:O42868	0.966	0.951	1.003E-26	197	0.454	0.447	O42868.pdb.gz	SSU72_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssu72 PE=1 SV=1
8	AFDB:P53538	0.922	0.871	4.031E-26	206	0.459	0.432	P53538.pdb.gz	SSU72_YEAST RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSU72 PE=1 SV=1
9	AFDB:P0ACZ2	0.372	0.470	8.609E-4	148	0.149	0.196	P0ACZ2.pdb.gz	ETP_ECOLI Low molecular weight protein-tyrosine-phosphatase Etp OS=Escherichia coli (strain K12) OX=83333 GN=etp PE=1 SV=1
10	PDB:1d1qA	0.393	0.464	8.924E-4	159	0.155	0.189	1d1qA.pdb.gz	Crystal structures of a low-molecular weight protein tyrosine phosphatase from Saccharomyces cerevisiae and its complex with the substrate p-nitrophenyl phosphate.
11	PDB:4z99A	0.423	0.486	1.224E-3	164	0.139	0.165	4z99A.pdb.gz
12	PDB:5jnuA	0.417	0.513	1.389E-3	153	0.139	0.176	5jnuA.pdb.gz
13	PDB:7btgA	0.439	0.528	1.480E-3	157	0.149	0.185	7btgA.pdb.gz
14	AFDB:P40347	0.415	0.487	1.839E-3	161	0.155	0.186	P40347.pdb.gz	PPAL_YEAST Low molecular weight phosphotyrosine protein phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LTP1 PE=1 SV=1
15	AFDB:P9WIA1	0.343	0.397	1.839E-3	163	0.165	0.196	P9WIA1.pdb.gz	PTPA_MYCTU Low molecular weight protein-tyrosine phosphatase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ptpA PE=1 SV=1
16	AFDB:Q9V397	0.344	0.115	2.687E-3	783	0.098	0.024	Q9V397.pdb.gz	Q9V397_DROME enoyl-CoA hydratase OS=Drosophila melanogaster OX=7227 GN=Mtpalpha PE=1 SV=1
17	PDB:2fekA	0.435	0.555	2.968E-3	147	0.155	0.204	2fekA.pdb.gz
18	PDB:2f7kA	0.278	0.185	8.163E-3	323	0.077	0.046	2f7kA.pdb.gz
19	PDB:6hrdA	0.325	0.240	8.696E-3	285	0.129	0.088	6hrdA.pdb.gz
20	PDB:7cuyA	0.356	0.428	9.264E-3	154	0.139	0.175	7cuyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NP77	3.20e-146	405	194	1.000	1.000	SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens OX=9606 GN=SSU72 PE=1 SV=1
2	Q9VWE4	3.63e-84	249	195	0.603	0.600	Q9VWE4_DROME RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Drosophila melanogaster OX=7227 GN=Ssu72 PE=1 SV=1
3	M9PHZ3	1.08e-81	242	194	0.598	0.598	M9PHZ3_DROME RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Drosophila melanogaster OX=7227 GN=Ssu72 PE=1 SV=1
4	Q22453	6.88e-78	233	197	0.567	0.558	SSU72_CAEEL RNA polymerase II subunit A C-terminal domain phosphatase ssup-72 OS=Caenorhabditis elegans OX=6239 GN=ssup-72 PE=1 SV=4
5	Q9C9T0	8.48e-70	212	193	0.505	0.508	Q9C9T0_ARATH RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Arabidopsis thaliana OX=3702 GN=SSU72 PE=1 SV=1
6	O42868	1.84e-61	191	197	0.454	0.447	SSU72_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssu72 PE=1 SV=1
7	P53538	6.48e-54	172	206	0.448	0.422	SSU72_YEAST RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSU72 PE=1 SV=1
8	Q9JID1	0.036	36.6	469	0.088	0.036	PDCD4_RAT Programmed cell death protein 4 OS=Rattus norvegicus OX=10116 GN=Pdcd4 PE=1 SV=2
9	Q53EL6	0.037	36.6	469	0.088	0.036	PDCD4_HUMAN Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2
10	Q61823	0.038	36.6	469	0.088	0.036	PDCD4_MOUSE Programmed cell death protein 4 OS=Mus musculus OX=10090 GN=Pdcd4 PE=1 SV=1
11	Q98TX3	0.44	33.5	467	0.082	0.034	PDCD4_CHICK Programmed cell death protein 4 OS=Gallus gallus OX=9031 GN=PDCD4 PE=2 SV=1
12	O70151	1.4	32.3	2456	0.119	0.009	O70151_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=2 SV=1
13	A0A0G2K1F2	1.6	32.0	2476	0.124	0.010	A0A0G2K1F2_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2
14	D3ZBE2	1.6	32.0	2459	0.124	0.010	D3ZBE2_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=4
15	E9PSQ0	1.6	32.0	2460	0.124	0.010	E9PSQ0_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2
16	A0A8I6ART3	1.8	32.0	2277	0.124	0.011	A0A8I6ART3_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=1
17	Q10751	5.6	30.4	1281	0.077	0.012	ACE_CHICK Angiotensin-converting enzyme OS=Gallus gallus OX=9031 GN=ACE PE=2 SV=2
18	A0A1D8PTQ2	6.7	30.0	907	0.149	0.032	A0A1D8PTQ2_CANAL Decapping enzyme complex catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCP2 PE=3 SV=1
19	E9Q4Z2	6.9	30.0	2448	0.134	0.011	ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus OX=10090 GN=Acacb PE=1 SV=1
20	Q9Z1T6	6.9	30.0	2097	0.077	0.007	FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus OX=10090 GN=Pikfyve PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04722 Ssu72	9e-89	307.6	Ssu72-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9739.XP_004315831.1

Rank	PPI partner	STRING score	Description
1	9739.XP_004311573.1	0.998	Cleavage and polyadenylation specificity factor subunit 2
2	9739.XP_004316777.1	0.998	Cleavage and polyadenylation specificity factor subunit 4 isoform 1
3	9739.XP_004319083.1	0.998	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 1 base in 1 codon
4	9739.XP_004323469.1	0.998	pre-mRNA 3'-end-processing factor FIP1 isoform 1
5	9739.XP_004323587.1	0.998	Symplekin
6	9739.XP_004318737.1	0.997	pre-mRNA 3' end processing protein WDR33
7	9739.XP_004321057.1	0.997	E3 ubiquitin-protein ligase RBBP6-like isoform 1
8	9739.XP_004320543.1	0.995	Cleavage and polyadenylation specificity factor subunit 3-like
9	9739.XP_004327234.1	0.994	DNA-directed RNA polymerase II subunit RPB1
10	9739.XP_004321059.1	0.988	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 4 ESTs, 11 Proteins
11	9739.XP_004326541.1	0.988	WD repeat-containing protein 82-like
12	9739.XP_004319237.1	0.984	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
13	9739.XP_004324360.1	0.984	Serine/threonine-protein phosphatase PP1-beta catalytic subunit-like isoform 1
14	9739.XP_004332768.1	0.984	Belongs to the PPP phosphatase family.
15	9739.XP_004310626.1	0.971	Cleavage stimulation factor subunit 2 tau variant-like isoform 1
16	9739.XP_004321764.1	0.971	Cleavage stimulation factor subunit 2-like isoform 1
17	9739.XP_004323054.1	0.971	Upstream in-frame stop codon
18	9739.XP_004321586.1	0.969	Polymerase that creates the 3'-poly(A) tail of mRNA's.
19	9739.XP_004318709.1	0.968	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 1 base in 1 codon
20	9739.XP_004331969.1	0.968	Polymerase that creates the 3'-poly(A) tail of mRNA's.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008420	1.000	RNA polymerase II CTD heptapeptide repeat phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0065007	0.986	biological regulation
GO:0006397	0.985	mRNA processing
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0036211	0.980	protein modification process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0031124	0.965	mRNA 3'-end processing
GO:0051252	0.963	regulation of RNA metabolic process
GO:0010468	0.928	regulation of gene expression
GO:0043631	0.927	RNA polyadenylation
GO:0006378	0.852	mRNA polyadenylation
GO:0006796	0.843	phosphate-containing compound metabolic process
GO:1903506	0.791	regulation of nucleic acid-templated transcription
GO:0006470	0.701	protein dephosphorylation
GO:0006355	0.669	regulation of DNA-templated transcription
GO:0006357	0.428	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.936	cytosol
GO:0032991	0.331	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]