StarFunc result for job id Q9NP81

User Input

>input (518 residues)
MAASMARRLWPLLTRRGFRPRGGCISNDSPRRSFTTEKRNRNLLYEYAREGYSALPQLDI
ERFCACPEEAAHALELRKGELRSADLPAIISTWQELRQLQEQIRSLEEEKAAVTEAVRAL
LANQDSGEVQQDPKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPDVPV
GDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTA
EVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPG
LEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT
SASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPA
LQSYLGTDRITAPTHVPLQYIGPNQPRKPGLPGQPAVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP81	1.000	1.000	6.806E-99	518	1.000	1.000	Q9NP81.pdb.gz	SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1
2	AFDB:Q9N0F3	0.946	0.946	4.738E-90	518	0.873	0.873	Q9N0F3.pdb.gz	SYSM_BOVIN Serine--tRNA ligase, mitochondrial OS=Bos taurus OX=9913 GN=SARS2 PE=1 SV=1
3	AFDB:Q9JJL8	0.943	0.943	9.746E-90	518	0.861	0.861	Q9JJL8.pdb.gz	SYSM_MOUSE Serine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Sars2 PE=1 SV=2
4	PDB:1wleB	0.894	0.987	2.360E-81	469	0.811	0.896	1wleB.pdb.gz	Dual-mode recognition of noncanonical tRNAs(Ser) by seryl-tRNA synthetase in mammalian mitochondria
5	PDB:7u2aB	0.839	0.982	8.450E-77	442	0.849	0.995	7u2aB.pdb.gz	Structural basis for shape-selective recognition and aminoacylation of a D-armless human mitochondrial tRNA.
6	AFDB:Q8RWT8	0.786	0.792	3.767E-48	514	0.336	0.339	Q8RWT8.pdb.gz	SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA7 PE=2 SV=1
7	AFDB:O51244	0.776	0.940	1.466E-44	425	0.313	0.381	O51244.pdb.gz	SYS_BORBU Serine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=serS PE=3 SV=1
8	AFDB:Q9UTB2	0.794	0.856	1.684E-43	479	0.299	0.324	Q9UTB2.pdb.gz	SYSM_SCHPO Serine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dia4 PE=3 SV=2
9	AFDB:P9WFT7	0.772	0.950	2.623E-41	419	0.276	0.341	P9WFT7.pdb.gz	SYS_MYCTU Serine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serS PE=1 SV=1
10	AFDB:C8VIL4	0.769	0.831	2.931E-41	478	0.299	0.324	C8VIL4.pdb.gz	C8VIL4_EMENI serine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10353 PE=4 SV=1
11	AFDB:P34945	0.772	0.944	2.931E-41	421	0.284	0.349	P34945.pdb.gz	SYS_THET2 Serine--tRNA ligase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=serS PE=1 SV=2
12	AFDB:P38705	0.723	0.834	3.762E-40	446	0.266	0.309	P38705.pdb.gz	SYSM_YEAST Serine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIA4 PE=1 SV=1
13	PDB:1serB	0.766	0.936	6.540E-40	421	0.284	0.349	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
14	PDB:6r1mB	0.774	0.932	2.617E-37	428	0.234	0.283	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
15	PDB:3vbbB	0.738	0.837	7.935E-35	454	0.216	0.247	3vbbB.pdb.gz
16	PDB:3lssA	0.746	0.874	9.907E-35	438	0.228	0.269	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
17	PDB:3lssB	0.733	0.806	1.587E-33	468	0.236	0.261	3lssB.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
18	PDB:4l87A	0.743	0.804	2.214E-33	476	0.226	0.246	4l87A.pdb.gz	Crystal Structure of Human Seryl-tRNA Synthetase and Ser-SA Complex Reveals a Molecular Lever Specific to Higher Eukaryotes.
19	PDB:6girA	0.680	0.856	4.555E-33	406	0.237	0.303	6girA.pdb.gz
20	PDB:1nj1A	0.479	0.533	1.199E-17	463	0.091	0.102	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JJL8	0.0	911	518	0.861	0.861	SYSM_MOUSE Serine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Sars2 PE=1 SV=2
2	Q9N0F3	0.0	939	518	0.873	0.873	SYSM_BOVIN Serine--tRNA ligase, mitochondrial OS=Bos taurus OX=9913 GN=SARS2 PE=1 SV=1
3	Q9NP81	0.0	1069	518	1.000	1.000	SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1
4	Q8RWT8	8.58e-105	325	514	0.317	0.319	SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA7 PE=2 SV=1
5	O51244	1.54e-93	293	425	0.303	0.369	SYS_BORBU Serine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=serS PE=3 SV=1
6	Q9VF85	1.38e-77	251	417	0.264	0.329	Q9VF85_DROME serine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=SerRS-m PE=1 SV=1
7	O18406	4.41e-77	247	322	0.249	0.401	O18406_DROME serine--tRNA ligase (Fragment) OS=Drosophila melanogaster OX=7227 GN=SerRS-m PE=4 SV=1
8	P38705	2.42e-70	233	446	0.280	0.325	SYSM_YEAST Serine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIA4 PE=1 SV=1
9	C8VIL4	1.16e-67	227	478	0.319	0.345	C8VIL4_EMENI serine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10353 PE=4 SV=1
10	Q9UTB2	2.35e-66	224	479	0.282	0.305	SYSM_SCHPO Serine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dia4 PE=3 SV=2
11	P34945	5.36e-64	216	421	0.274	0.337	SYS_THET2 Serine--tRNA ligase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=serS PE=1 SV=2
12	P9WFT7	1.51e-56	196	419	0.270	0.334	SYS_MYCTU Serine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serS PE=1 SV=1
13	Q39230	2.49e-56	196	451	0.245	0.282	SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g27470 PE=1 SV=1
14	Q7KWQ2	1.25e-52	186	451	0.236	0.271	SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=serS PE=1 SV=1
15	P26638	7.28e-49	178	512	0.197	0.199	SYSC_MOUSE Serine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Sars1 PE=1 SV=3
16	Q18678	1.46e-48	176	487	0.191	0.203	SYSC_CAEEL Probable serine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=sars-1 PE=3 SV=1
17	P49591	1.79e-48	177	514	0.195	0.196	SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3
18	Q9VQL1	1.47e-45	169	501	0.197	0.204	Q9VQL1_DROME serine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=SerRS PE=1 SV=1
19	Q5T5C7	3.54e-45	168	536	0.195	0.188	Q5T5C7_HUMAN serine--tRNA ligase OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=1
20	Q6DRC0	1.06e-44	166	515	0.189	0.190	SYSC_DANRE Serine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=sars1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10073 DUF2312	90	14.1	Uncharacterized protein conserved in bacteria (DUF2312)
2	PF07303 Occludin_ELL	61	15.8	Occludin homology domain
3	PF02403 Seryl_tRNA_N	0.0047	28.5	Seryl-tRNA synthetase N-terminal domain
4	PF17926 TetR_C_21	4.7e+02	12.4	Tetracyclin repressor-like, C-terminal domain
5	PF00587 tRNA-synt_2b	3.9e-22	90.6	tRNA synthetase class II core domain (G, H, P, S and T)
6	PF09957 VapB_antitoxin	4.7e+02	12.1	Bacterial antitoxin of type II TA system, VapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008962903.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008967620.1	0.995	L-seryl-tRNA(Sec) kinase isoform X1
2	9597.XP_008963768.1	0.934	tyrosine--tRNA ligase, cytoplasmic-like
3	9597.XP_003807230.1	0.926	glutamyl-prolyl-tRNA synthetase
4	9597.XP_008955705.1	0.866	cysteinyl-tRNA synthetase 2, mitochondrial (putative)
5	9597.XP_003833426.1	0.858	glycyl-tRNA synthetase
6	9597.XP_008976744.1	0.857	Belongs to the class-I aminoacyl-tRNA synthetase family.
7	9597.XP_008974720.1	0.852	Belongs to the class-I aminoacyl-tRNA synthetase family.
8	9597.XP_003815038.1	0.848	prolyl-tRNA synthetase 2, mitochondrial (putative)
9	9597.XP_008958682.1	0.844	seryl-tRNA synthetase
10	9597.XP_003824722.1	0.832	aspartyl-tRNA synthetase 2, mitochondrial
11	9597.XP_003816089.1	0.824	cysteinyl-tRNA synthetase
12	9597.XP_003829595.1	0.761	lysyl-tRNA synthetase
13	9597.XP_003813775.1	0.755	tyrosyl-tRNA synthetase 2
14	9597.XP_003829211.1	0.754	histidyl-tRNA synthetase
15	9597.XP_003806343.1	0.752	Tryptophanyl tRNA synthetase 2, mitochondrial
16	9597.XP_003817351.1	0.751	threonyl-tRNA synthetase 2, mitochondrial (putative)
17	9597.XP_003811419.1	0.745	DNA polymerase gamma 2, accessory subunit
18	9597.XP_003818537.1	0.742	leucyl-tRNA synthetase 2, mitochondrial
19	9597.XP_003811107.1	0.732	Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
20	9597.XP_003832904.1	0.725	Belongs to the class-I aminoacyl-tRNA synthetase family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	0.999	heterocyclic compound binding
GO:0097159	0.999	organic cyclic compound binding
GO:0005515	0.997	protein binding
GO:0004828	0.997	serine-tRNA ligase activity
GO:0003723	0.988	RNA binding
GO:0005524	0.981	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0006412	0.995	translation
GO:0006418	0.991	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.993	intracellular organelle lumen
GO:0005759	0.861	mitochondrial matrix
GO:0031981	0.345	nuclear lumen
GO:0005654	0.317	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12292	0.997	ATP + L-serine + tRNA(Ser) = AMP + diphosphate + H(+) + L-seryl-tRNA(Ser)
EC:6.1.1.11	0.997	serine--tRNA ligase.

[back to server]