StarFunc result for job id Q9NP84

User Input

>input (129 residues)
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH
SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPAVALIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP84	1.000	1.000	1.111E-21	129	1.000	1.000	Q9NP84.pdb.gz	TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A OS=Homo sapiens OX=9606 GN=TNFRSF12A PE=1 SV=1
2	AFDB:Q9CR75	0.820	0.820	9.088E-18	129	0.798	0.798	Q9CR75.pdb.gz	TNR12_MOUSE Tumor necrosis factor receptor superfamily member 12A OS=Mus musculus OX=10090 GN=Tnfrsf12a PE=2 SV=1
3	AFDB:Q6SIX7	0.400	0.415	2.242E-7	120	0.357	0.383	Q6SIX7.pdb.gz	Q6SIX7_XENLA Fn14 OS=Xenopus laevis OX=8355 GN=tnfrsf12a.L PE=1 SV=1
4	AFDB:Q02223	0.316	0.226	2.465E-1	184	0.155	0.109	Q02223.pdb.gz	TNR17_HUMAN Tumor necrosis factor receptor superfamily member 17 OS=Homo sapiens OX=9606 GN=TNFRSF17 PE=1 SV=2
5	AFDB:Q6UXU6	0.290	0.242	4.716E-1	159	0.217	0.176	Q6UXU6.pdb.gz	TMM92_HUMAN Transmembrane protein 92 OS=Homo sapiens OX=9606 GN=TMEM92 PE=1 SV=1
6	AFDB:Q7KQK5	0.263	0.072	6.293E-1	622	0.062	0.013	Q7KQK5.pdb.gz	Q7KQK5_PLAF7 Apical membrane antigen 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1133400 PE=1 SV=1
7	AFDB:Q86P34	0.227	0.053	6.763E-1	765	0.140	0.024	Q86P34.pdb.gz	Q86P34_DROME RE38148p OS=Drosophila melanogaster OX=7227 GN=Lgr3 PE=2 SV=1
8	AFDB:A0PJX4	0.283	0.180	7.811E-1	238	0.186	0.101	A0PJX4.pdb.gz	SHSA3_HUMAN Protein shisa-3 homolog OS=Homo sapiens OX=9606 GN=SHISA3 PE=1 SV=1
9	AFDB:Q9VEX0	0.296	0.056	9.697E-1	1114	0.116	0.013	Q9VEX0.pdb.gz	SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster OX=7227 GN=Sulf1 PE=1 SV=1
10	AFDB:A2AR95	0.302	0.142	1.042	345	0.124	0.046	A2AR95.pdb.gz	LRAD3_MOUSE Low-density lipoprotein receptor class A domain-containing protein 3 OS=Mus musculus OX=10090 GN=Ldlrad3 PE=1 SV=1
11	PDB:6vxkB	0.154	0.036	2.298	747	0.054	0.009	6vxkB.pdb.gz
12	PDB:5im3A	0.144	0.035	3.541	874	0.078	0.011	5im3A.pdb.gz	Structural Mechanism of Allosteric Activity Regulation in a Ribonucleotide Reductase with Double ATP Cones.
13	PDB:1ei6A	0.103	0.041	5.077	404	0.008	0.002	1ei6A.pdb.gz	Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
14	PDB:5gm6f	0.244	0.304	5.457	102	0.085	0.108	5gm6f.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:4xb6E	0.189	0.166	6.303	149	0.047	0.040	4xb6E.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
16	PDB:5fguA	0.158	0.046	6.303	494	0.031	0.008	5fguA.pdb.gz
17	PDB:7nfxy	0.117	0.108	7.280	147	0.109	0.095	7nfxy.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
18	PDB:3bybA	0.085	0.188	7.824	58	0.039	0.086	3bybA.pdb.gz
19	PDB:5venA	0.095	0.034	8.409	382	0.016	0.005	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
20	PDB:3gyxA	0.129	0.030	9.037	662	0.039	0.008	3gyxA.pdb.gz	Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NP84	1.74e-87	252	129	1.000	1.000	TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A OS=Homo sapiens OX=9606 GN=TNFRSF12A PE=1 SV=1
2	Q9CR75	1.44e-54	169	129	0.814	0.814	TNR12_MOUSE Tumor necrosis factor receptor superfamily member 12A OS=Mus musculus OX=10090 GN=Tnfrsf12a PE=2 SV=1
3	Q6SIX7	2.40e-16	71.6	120	0.279	0.300	Q6SIX7_XENLA Fn14 OS=Xenopus laevis OX=8355 GN=tnfrsf12a.L PE=1 SV=1
4	A0A4X1TSK7	0.60	32.0	636	0.132	0.027	A0A4X1TSK7_PIG Sodium-dependent multivitamin transporter OS=Sus scrofa OX=9823 PE=3 SV=1
5	Q9WVH8	5.8	28.9	448	0.132	0.038	FBLN5_RAT Fibulin-5 OS=Rattus norvegicus OX=10116 GN=Fbln5 PE=2 SV=1
6	Q8NFZ0	7.2	28.5	1043	0.085	0.011	FBH1_HUMAN F-box DNA helicase 1 OS=Homo sapiens OX=9606 GN=FBH1 PE=1 SV=2
7	Q9WVH9	8.4	28.5	448	0.132	0.038	FBLN5_MOUSE Fibulin-5 OS=Mus musculus OX=10090 GN=Fbln5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12191 stn_TNFRSF12A	1.2e-73	256.9	Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006496

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012158	0.956	TNF receptor-associated factor 2
2	60711.ENSCSAP00000007689	0.912	TNFSF12-TNFSF13 readthrough
3	60711.ENSCSAP00000009381	0.813	TNF receptor-associated factor 1
4	60711.ENSCSAP00000006881	0.710	Lymphotoxin beta receptor (TNFR superfamily, member 3)
5	60711.ENSCSAP00000006382	0.705	Belongs to the TNF receptor-associated factor family.
6	60711.ENSCSAP00000014203	0.696	Tumor necrosis factor receptor superfamily, member 11a, NFKB activator
7	60711.ENSCSAP00000011407	0.681	Belongs to the TNF receptor-associated factor family.
8	60711.ENSCSAP00000014823	0.677	Baculoviral IAP repeat containing 2
9	60711.ENSCSAP00000017197	0.656	Tumor necrosis factor receptor superfamily, member 1B
10	60711.ENSCSAP00000013504	0.625	Tumor necrosis factor (ligand) superfamily, member 13b
11	60711.ENSCSAP00000001791	0.612	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
12	60711.ENSCSAP00000002039	0.583	Tumor necrosis factor receptor superfamily, member 13C
13	60711.ENSCSAP00000005779	0.571	Tumor necrosis factor (ligand) superfamily, member 14
14	60711.ENSCSAP00000008499	0.548	Uncharacterized protein
15	60711.ENSCSAP00000010872	0.544	CD40 molecule, TNF receptor superfamily member 5
16	60711.ENSCSAP00000000052	0.523	Mitogen-activated protein kinase kinase kinase 14
17	60711.ENSCSAP00000006908	0.517	Tumor necrosis factor receptor superfamily, member 1A
18	60711.ENSCSAP00000006328	0.512	Tumor necrosis factor, alpha-induced protein 2
19	60711.ENSCSAP00000007928	0.512	Fibroblast growth factor 11
20	60711.ENSCSAP00000015904	0.512	Junctional adhesion molecule 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0042981	0.987	regulation of apoptotic process
GO:0009967	0.985	positive regulation of signal transduction
GO:0080134	0.965	regulation of response to stress
GO:0043065	0.952	positive regulation of apoptotic process
GO:2001233	0.945	regulation of apoptotic signaling pathway
GO:0009987	0.929	cellular process
GO:2001236	0.929	regulation of extrinsic apoptotic signaling pathway
GO:0050896	0.925	response to stimulus
GO:2001235	0.876	positive regulation of apoptotic signaling pathway
GO:0051716	0.869	cellular response to stimulus
GO:0023052	0.867	signaling
GO:0007154	0.867	cell communication
GO:0007165	0.843	signal transduction
GO:2001238	0.827	positive regulation of extrinsic apoptotic signaling pathway
GO:1903034	0.763	regulation of response to wounding
GO:0061041	0.646	regulation of wound healing
GO:0051239	0.466	regulation of multicellular organismal process
GO:0007166	0.456	cell surface receptor signaling pathway
GO:0006915	0.423	apoptotic process
GO:1902531	0.361	regulation of intracellular signal transduction
GO:0048519	0.309	negative regulation of biological process
GO:0019222	0.307	regulation of metabolic process
GO:0051240	0.304	positive regulation of multicellular organismal process
GO:1902533	0.303	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.527	cytoplasm
GO:0043226	0.485	organelle
GO:0043227	0.484	membrane-bounded organelle
GO:0043229	0.479	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]