StarFunc result for job id Q9NP91

User Input

>input (592 residues)
MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLY
LELAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDP
LPWSVCPLNGNHTGYDEECEKASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLV
VYLCILRGTESTGKVVYFTASLPYCVLIIYLIRGLTLHGATNGLMYMFTPKIEQLANPKA
WINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVSLINSFTSIFASIVTFSIYGF
KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSL
ESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAV
CYVYGLRRFESDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWD
ASQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64093	0.998	0.959	1.031E-79	616	0.909	0.873	Q64093.pdb.gz	S6A20_RAT Sodium- and chloride-dependent transporter XTRP3 OS=Rattus norvegicus OX=10116 GN=Slc6a20 PE=2 SV=1
2	AFDB:O88575	0.990	0.923	1.976E-76	635	0.868	0.809	O88575.pdb.gz	S620B_MOUSE Sodium- and chloride-dependent transporter XTRP3B OS=Mus musculus OX=10090 GN=Slc6a20b PE=1 SV=3
3	AFDB:F6SPX0	0.988	0.891	1.055E-75	657	0.865	0.779	F6SPX0.pdb.gz	F6SPX0_MONDO Transporter OS=Monodelphis domestica OX=13616 GN=SLC6A20 PE=3 SV=3
4	AFDB:Q96N87	0.971	0.916	1.554E-54	628	0.476	0.449	Q96N87.pdb.gz	S6A18_HUMAN Inactive sodium-dependent neutral amino acid transporter B(0)AT3 OS=Homo sapiens OX=9606 GN=SLC6A18 PE=2 SV=2
5	AFDB:O88576	0.971	0.935	2.011E-54	615	0.468	0.450	O88576.pdb.gz	S6A18_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Mus musculus OX=10090 GN=Slc6a18 PE=1 SV=1
6	AFDB:B5X4N9	0.966	0.902	1.389E-53	635	0.465	0.433	B5X4N9.pdb.gz	B5X4N9_SALSA Transporter OS=Salmo salar OX=8030 GN=S6A19 PE=2 SV=1
7	AFDB:R4N225	0.967	0.904	8.802E-53	634	0.454	0.424	R4N225.pdb.gz	R4N225_DICLA Transporter OS=Dicentrarchus labrax OX=13489 GN=SLC6A19 PE=2 SV=1
8	AFDB:Q695T7	0.951	0.889	1.676E-52	634	0.459	0.429	Q695T7.pdb.gz	S6A19_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Homo sapiens OX=9606 GN=SLC6A19 PE=1 SV=1
9	AFDB:Q2A865	0.961	0.898	3.791E-52	634	0.463	0.432	Q2A865.pdb.gz	S6A19_RAT Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Rattus norvegicus OX=10116 GN=Slc6a19 PE=1 SV=2
10	AFDB:Q9H2J7	0.937	0.762	8.485E-50	730	0.439	0.356	Q9H2J7.pdb.gz	S6A15_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1
11	PDB:7dwxA	0.937	0.917	6.099E-47	605	0.456	0.446	7dwxA.pdb.gz	Structural basis for the different states of the spike protein of SARS-CoV-2 in complex with ACE2.
12	PDB:6vrhA	0.805	0.878	4.029E-33	541	0.323	0.353	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
13	PDB:7sk2A	0.740	0.818	1.409E-29	532	0.341	0.380	7sk2A.pdb.gz	Structural basis of GABA reuptake inhibition.
14	PDB:7s1xB	0.447	0.323	7.135E-6	871	0.111	0.076	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
15	PDB:5j4nA	0.461	0.601	4.332E-5	437	0.105	0.142	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
16	PDB:7cmhB	0.428	0.526	4.332E-5	458	0.106	0.138	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
17	PDB:4djiA	0.409	0.471	2.520E-4	493	0.128	0.154	4djiA.pdb.gz
18	PDB:7d10A	0.368	0.461	2.520E-4	446	0.098	0.130	7d10A.pdb.gz
19	PDB:7dskB	0.406	0.496	2.520E-4	464	0.130	0.166	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
20	PDB:7p9uB	0.305	0.379	2.520E-4	455	0.100	0.130	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5X4N9	0.0	575	635	0.466	0.435	B5X4N9_SALSA Transporter OS=Salmo salar OX=8030 GN=S6A19 PE=2 SV=1
2	F6SPX0	0.0	1068	657	0.867	0.781	F6SPX0_MONDO Transporter OS=Monodelphis domestica OX=13616 GN=SLC6A20 PE=3 SV=3
3	O88575	0.0	1067	635	0.868	0.809	S620B_MOUSE Sodium- and chloride-dependent transporter XTRP3B OS=Mus musculus OX=10090 GN=Slc6a20b PE=1 SV=3
4	O88576	0.0	594	615	0.470	0.452	S6A18_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Mus musculus OX=10090 GN=Slc6a18 PE=1 SV=1
5	Q2A865	0.0	595	634	0.468	0.437	S6A19_RAT Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Rattus norvegicus OX=10116 GN=Slc6a19 PE=1 SV=2
6	Q62687	0.0	589	615	0.468	0.450	S6A18_RAT Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Rattus norvegicus OX=10116 GN=Slc6a18 PE=2 SV=1
7	Q64093	0.0	1098	616	0.909	0.873	S6A20_RAT Sodium- and chloride-dependent transporter XTRP3 OS=Rattus norvegicus OX=10116 GN=Slc6a20 PE=2 SV=1
8	Q695T7	0.0	587	634	0.458	0.427	S6A19_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Homo sapiens OX=9606 GN=SLC6A19 PE=1 SV=1
9	Q8VDB9	0.0	1109	592	0.921	0.921	S620A_MOUSE Sodium- and chloride-dependent transporter XTRP3A OS=Mus musculus OX=10090 GN=Slc6a20a PE=1 SV=1
10	Q96N87	0.0	582	628	0.471	0.444	S6A18_HUMAN Inactive sodium-dependent neutral amino acid transporter B(0)AT3 OS=Homo sapiens OX=9606 GN=SLC6A18 PE=2 SV=2
11	Q9D687	0.0	600	634	0.468	0.437	S6A19_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Mus musculus OX=10090 GN=Slc6a19 PE=1 SV=1
12	Q9NP91	0.0	1209	592	1.000	1.000	S6A20_HUMAN Sodium- and chloride-dependent transporter XTRP3 OS=Homo sapiens OX=9606 GN=SLC6A20 PE=1 SV=1
13	R4N225	0.0	597	634	0.459	0.429	R4N225_DICLA Transporter OS=Dicentrarchus labrax OX=13489 GN=SLC6A19 PE=2 SV=1
14	Q9H2J7	3.99e-176	518	730	0.454	0.368	S6A15_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1
15	Q9H1V8	8.56e-172	507	727	0.429	0.349	S6A17_HUMAN Sodium-dependent neutral amino acid transporter SLC6A17 OS=Homo sapiens OX=9606 GN=SLC6A17 PE=1 SV=3
16	Q8BJI1	1.64e-170	503	727	0.438	0.356	S6A17_MOUSE Sodium-dependent neutral amino acid transporter SLC6A17 OS=Mus musculus OX=10090 GN=Slc6a17 PE=1 SV=1
17	P31662	4.30e-170	503	727	0.426	0.347	S6A17_RAT Sodium-dependent neutral amino acid transporter SLC6A17 OS=Rattus norvegicus OX=10116 GN=Slc6a17 PE=1 SV=1
18	Q8BG16	2.12e-169	501	729	0.426	0.346	S6A15_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Mus musculus OX=10090 GN=Slc6a15 PE=1 SV=1
19	P30531	8.37e-113	351	599	0.329	0.326	SC6A1_HUMAN Sodium- and chloride-dependent GABA transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A1 PE=1 SV=2
20	P23978	1.26e-112	350	599	0.331	0.327	SC6A1_RAT Sodium- and chloride-dependent GABA transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc6a1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00209 SNF	1.8e-171	583.1	Sodium:neurotransmitter symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334223	0.932	Proton-coupled amino acid transporter 2
2	9606.ENSP00000478639	0.823	Amino acid transporter
3	9606.ENSP00000017003	0.764	Xylosyltransferase 2
4	9606.ENSP00000261381	0.701	Xylosyltransferase 1
5	9606.ENSP00000023064	0.661	B(0,+)-type amino acid transporter 1
6	9606.ENSP00000231121	0.596	Heart- and neural crest derivatives-expressed protein 1
7	9606.ENSP00000369699	0.530	Collectrin
8	9606.ENSP00000435954	0.500	Potassium voltage-gated channel subfamily V member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015175	0.999	neutral L-amino acid transmembrane transporter activity
GO:0015179	0.998	L-amino acid transmembrane transporter activity
GO:0005283	0.995	amino acid:sodium symporter activity
GO:0015193	0.993	L-proline transmembrane transporter activity
GO:0005515	0.987	protein binding
GO:0008509	0.733	monoatomic anion transmembrane transporter activity
GO:0015378	0.693	sodium:chloride symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098657	0.998	import into cell
GO:1905039	0.997	carboxylic acid transmembrane transport
GO:0015807	0.995	L-amino acid transport
GO:0015804	0.992	neutral amino acid transport
GO:0089718	0.986	amino acid import across plasma membrane
GO:1902475	0.983	L-alpha-amino acid transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098590	0.996	plasma membrane region
GO:0045177	0.985	apical part of cell
GO:0016324	0.905	apical plasma membrane
GO:0005622	0.645	intracellular anatomical structure
GO:0005737	0.549	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)
RHEA:29823	0.693	chloride(in) = chloride(out)

[back to server]