StarFunc result for job id Q9NP95

User Input

>input (211 residues)
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EST9	0.780	0.776	4.666E-37	212	0.948	0.943	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
2	AFDB:Q2LJ24	0.739	0.749	2.699E-31	208	0.758	0.769	Q2LJ24.pdb.gz	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
3	AFDB:P31371	0.788	0.799	7.925E-31	208	0.697	0.707	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
4	AFDB:Q38PL0	0.747	0.758	8.767E-29	208	0.711	0.721	Q38PL0.pdb.gz	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
5	PDB:3f1rA	0.730	0.978	3.276E-28	157	0.739	0.994	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
6	AFDB:O43320	0.747	0.762	1.770E-27	207	0.616	0.628	O43320.pdb.gz	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
7	AFDB:Q2HXK8	0.679	0.705	9.051E-25	203	0.559	0.581	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
8	AFDB:P11487	0.642	0.570	1.485E-17	239	0.360	0.318	P11487.pdb.gz	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
9	AFDB:P48802	0.634	0.525	1.572E-17	256	0.346	0.285	P48802.pdb.gz	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
10	AFDB:P48807	0.589	0.470	5.170E-17	266	0.379	0.301	P48807.pdb.gz	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
11	AFDB:P70492	0.614	0.603	5.472E-17	215	0.322	0.316	P70492.pdb.gz	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
12	PDB:4jq0A	0.598	0.884	4.728E-14	141	0.237	0.355	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.580	0.801	1.683E-12	151	0.275	0.384	1ry7A.pdb.gz
14	PDB:4qd2B	0.513	0.729	1.566E-5	143	0.066	0.098	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
15	PDB:6b0tA	0.503	0.227	4.867E-5	487	0.085	0.037	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
16	PDB:1hcdA	0.437	0.717	1.077E-4	118	0.081	0.144	1hcdA.pdb.gz
17	PDB:3malA	0.423	0.487	3.346E-4	181	0.100	0.116	3malA.pdb.gz
18	PDB:7t3qA	0.479	0.057	5.899E-4	2103	0.095	0.010	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:4iybA	0.482	0.702	9.827E-4	140	0.095	0.143	4iybA.pdb.gz	Macrolepiota procera ricin B-like lectin (MPL) in complex with galactose
20	PDB:4qd2C	0.494	0.372	1.233E-3	286	0.062	0.045	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NP95	1.29e-155	431	211	1.000	1.000	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
2	Q9ESL9	3.08e-149	414	211	0.953	0.953	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
3	Q9EST9	3.98e-148	412	212	0.953	0.948	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
4	Q2LJ24	9.25e-115	327	208	0.758	0.769	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
5	Q38PL0	6.79e-106	305	208	0.701	0.712	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
6	P31371	2.14e-103	298	208	0.697	0.707	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
7	P36364	2.23e-103	298	208	0.697	0.707	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
8	P54130	2.23e-103	298	208	0.697	0.707	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
9	O54769	3.62e-94	275	207	0.630	0.643	FGF16_RAT Fibroblast growth factor 16 OS=Rattus norvegicus OX=10116 GN=Fgf16 PE=2 SV=1
10	O43320	9.39e-94	274	207	0.630	0.643	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
11	Q2HXK8	5.50e-90	265	203	0.630	0.655	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
12	Q92915	9.63e-36	127	247	0.289	0.247	FGF14_HUMAN Fibroblast growth factor 14 OS=Homo sapiens OX=9606 GN=FGF14 PE=1 SV=1
13	Q9ESS2	1.35e-35	125	162	0.327	0.426	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
14	P70379	1.89e-35	127	247	0.289	0.247	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
15	Q8R5L7	1.97e-35	127	247	0.289	0.247	FGF14_RAT Fibroblast growth factor 14 OS=Rattus norvegicus OX=10116 GN=Fgf14 PE=2 SV=1
16	O42407	2.53e-35	125	212	0.280	0.278	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
17	P48807	2.58e-35	127	266	0.336	0.267	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
18	O15520	3.01e-35	125	208	0.275	0.279	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
19	P15656	3.25e-35	127	264	0.332	0.265	FGF5_MOUSE Fibroblast growth factor 5 OS=Mus musculus OX=10090 GN=Fgf5 PE=2 SV=1
20	P70492	3.62e-35	125	215	0.275	0.270	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	3.4e-43	158.0	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000180166

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393312	0.951	Fibroblast growth factor receptor 1
2	9606.ENSP00000263025	0.926	Mitogen-activated protein kinase 3
3	9606.ENSP00000321455	0.922	Calcium uptake protein 3, mitochondrial
4	9606.ENSP00000371811	0.920	Calcium uptake protein 2, mitochondrial
5	9606.ENSP00000215832	0.917	Mitogen-activated protein kinase 1
6	9606.ENSP00000256078	0.915	GTPase KRas
7	9606.ENSP00000407586	0.915	GTPase HRas
8	9606.ENSP00000358548	0.914	GTPase NRas
9	9606.ENSP00000262648	0.904	Anosmin-1
10	9606.ENSP00000410294	0.864	Fibroblast growth factor receptor 2
11	9606.ENSP00000292408	0.850	Fibroblast growth factor receptor 4
12	9606.ENSP00000339824	0.847	Fibroblast growth factor receptor 3
13	9606.ENSP00000263923	0.800	Vascular endothelial growth factor receptor 2
14	9606.ENSP00000282397	0.754	Vascular endothelial growth factor receptor 1
15	9606.ENSP00000261937	0.737	Vascular endothelial growth factor receptor 3
16	9606.ENSP00000369375	0.736	Angiopoietin-1 receptor
17	9606.ENSP00000261799	0.720	Platelet-derived growth factor receptor beta
18	9606.ENSP00000275493	0.720	Epidermal growth factor receptor
19	9606.ENSP00000288135	0.715	Mast/stem cell growth factor receptor Kit
20	9606.ENSP00000369442	0.713	Klotho

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0005104	0.995	fibroblast growth factor receptor binding
GO:0097367	0.629	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0007165	0.976	signal transduction
GO:0042127	0.975	regulation of cell population proliferation
GO:0048519	0.967	negative regulation of biological process
GO:0007166	0.965	cell surface receptor signaling pathway
GO:0032502	0.957	developmental process
GO:0070848	0.947	response to growth factor
GO:0008284	0.931	positive regulation of cell population proliferation
GO:0048856	0.920	anatomical structure development
GO:0007169	0.919	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048583	0.917	regulation of response to stimulus
GO:0071363	0.895	cellular response to growth factor stimulus
GO:0071774	0.871	response to fibroblast growth factor
GO:0032501	0.856	multicellular organismal process
GO:0023051	0.834	regulation of signaling
GO:0010646	0.830	regulation of cell communication
GO:0009966	0.807	regulation of signal transduction
GO:0051239	0.793	regulation of multicellular organismal process
GO:0043408	0.790	regulation of MAPK cascade
GO:0048584	0.788	positive regulation of response to stimulus
GO:0044344	0.786	cellular response to fibroblast growth factor stimulus
GO:0019222	0.777	regulation of metabolic process
GO:0008543	0.777	fibroblast growth factor receptor signaling pathway
GO:0007275	0.740	multicellular organism development
GO:0060255	0.720	regulation of macromolecule metabolic process
GO:0050793	0.710	regulation of developmental process
GO:0048523	0.705	negative regulation of cellular process
GO:0010647	0.691	positive regulation of cell communication
GO:0023056	0.683	positive regulation of signaling
GO:0048731	0.651	system development
GO:0009893	0.617	positive regulation of metabolic process
GO:1902533	0.596	positive regulation of intracellular signal transduction
GO:0080090	0.591	regulation of primary metabolic process
GO:0031323	0.591	regulation of cellular metabolic process
GO:0030154	0.518	cell differentiation
GO:0048513	0.512	animal organ development
GO:0010604	0.509	positive regulation of macromolecule metabolic process
GO:0032879	0.490	regulation of localization
GO:0010941	0.482	regulation of cell death
GO:0043410	0.474	positive regulation of MAPK cascade
GO:0051171	0.436	regulation of nitrogen compound metabolic process
GO:0051049	0.431	regulation of transport
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0045595	0.405	regulation of cell differentiation
GO:0051173	0.404	positive regulation of nitrogen compound metabolic process
GO:0010468	0.346	regulation of gene expression
GO:0042981	0.317	regulation of apoptotic process
GO:0009653	0.309	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.950	cell periphery
GO:0005622	0.737	intracellular anatomical structure
GO:0005886	0.493	plasma membrane
GO:0005615	0.478	extracellular space
GO:0005737	0.348	cytoplasm
GO:0043226	0.307	organelle
GO:0043227	0.303	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]