StarFunc result for job id Q9NPA0

User Input

>input (242 residues)
MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQD
WISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRA
RYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLP
KVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK
RR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPA0	1.000	1.000	4.834E-44	242	1.000	1.000	Q9NPA0.pdb.gz	EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens OX=9606 GN=EMC7 PE=1 SV=1
2	AFDB:A1ZA83	0.546	0.540	4.618E-19	245	0.302	0.298	A1ZA83.pdb.gz	A1ZA83_DROME ER membrane protein complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=EMC7 PE=1 SV=1
3	AFDB:Q8VY97	0.422	0.485	2.261E-13	202	0.231	0.277	Q8VY97.pdb.gz	Y4213_ARATH ER membrane protein complex subunit 7 homolog OS=Arabidopsis thaliana OX=3702 GN=At4g32130 PE=2 SV=1
4	AFDB:Q84JM6	0.428	0.481	4.236E-12	210	0.182	0.210	Q84JM6.pdb.gz	Q84JM6_ARATH ER membrane protein complex subunit-like protein (DUF2012) OS=Arabidopsis thaliana OX=3702 GN=At2g25310 PE=1 SV=1
5	AFDB:O94694	0.402	0.498	7.464E-10	189	0.099	0.127	O94694.pdb.gz	YG1A_SCHPO UPF0620 protein C83.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC83.10 PE=3 SV=1
6	AFDB:A0A0D5CDW0	0.151	0.116	3.450E-4	333	0.174	0.126	A0A0D5CDW0.pdb.gz	A0A0D5CDW0_ICTPU SLAM family member 7 precursor OS=Ictalurus punctatus OX=7998 GN=slamf7 PE=2 SV=1
7	AFDB:P42787	0.265	0.052	5.463E-4	1406	0.095	0.016	P42787.pdb.gz	CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster OX=7227 GN=svr PE=1 SV=2
8	AFDB:P08921	0.185	0.140	8.651E-4	344	0.161	0.113	P08921.pdb.gz	CD2_RAT T-cell surface antigen CD2 OS=Rattus norvegicus OX=10116 GN=Cd2 PE=1 SV=2
9	AFDB:E9QDP8	0.153	0.107	1.724E-3	372	0.136	0.089	E9QDP8.pdb.gz	E9QDP8_DANRE Interleukin 7 receptor OS=Danio rerio OX=7955 GN=il-7ra PE=4 SV=2
10	AFDB:A0A1C9HIH9	0.173	0.098	3.639E-3	475	0.120	0.061	A0A1C9HIH9.pdb.gz	A0A1C9HIH9_HUMAN Erythroblast membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=3 SV=1
11	PDB:5ttdA	0.215	0.126	1.973E-2	491	0.070	0.035	5ttdA.pdb.gz	Engineering a Lys-Asn isopeptide bond into an immunoglobulin-like protein domain enhances its stability.
12	PDB:5yzgY	0.137	0.159	3.505E-2	204	0.120	0.142	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:1h8lA	0.219	0.144	1.044E-1	380	0.074	0.047	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
14	PDB:7x3kB	0.111	0.063	1.044E-1	506	0.041	0.020	7x3kB.pdb.gz
15	PDB:3uafA	0.196	0.330	1.751E-1	117	0.037	0.077	3uafA.pdb.gz
16	PDB:3duzA	0.104	0.072	1.965E-1	418	0.083	0.048	3duzA.pdb.gz
17	PDB:6rrmA	0.100	0.076	2.334E-1	351	0.054	0.037	6rrmA.pdb.gz	Targeting the Mycobacterium tuberculosis transpeptidase LdtMt2with cysteine-reactive inhibitors including ebselen.
18	PDB:5cltA	0.163	0.072	2.619E-1	646	0.054	0.020	5cltA.pdb.gz	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose
19	PDB:1uwyA	0.170	0.110	3.111E-1	393	0.054	0.033	1uwyA.pdb.gz	Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity
20	PDB:6jzkA	0.193	0.144	3.697E-1	350	0.062	0.043	6jzkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPA0	4.46e-177	488	242	1.000	1.000	EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens OX=9606 GN=EMC7 PE=1 SV=1
2	A1ZA83	1.47e-27	107	245	0.264	0.261	A1ZA83_DROME ER membrane protein complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=EMC7 PE=1 SV=1
3	Q8VY97	1.56e-14	72.0	202	0.194	0.233	Y4213_ARATH ER membrane protein complex subunit 7 homolog OS=Arabidopsis thaliana OX=3702 GN=At4g32130 PE=2 SV=1
4	Q84JM6	1.46e-13	69.3	210	0.190	0.219	Q84JM6_ARATH ER membrane protein complex subunit-like protein (DUF2012) OS=Arabidopsis thaliana OX=3702 GN=At2g25310 PE=1 SV=1
5	O94694	0.047	36.2	189	0.149	0.190	YG1A_SCHPO UPF0620 protein C83.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC83.10 PE=3 SV=1
6	P33450	3.3	31.6	5147	0.062	0.003	FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3
7	Q9W4N9	5.2	30.8	911	0.066	0.018	Q9W4N9_DROME Gaulos, isoform A OS=Drosophila melanogaster OX=7227 GN=Glos PE=2 SV=2
8	Q5JPE7	8.8	30.0	1267	0.103	0.020	NOMO2_HUMAN BOS complex subunit NOMO2 OS=Homo sapiens OX=9606 GN=NOMO2 PE=1 SV=1
9	Q15155	8.9	30.0	1222	0.103	0.020	NOMO1_HUMAN BOS complex subunit NOMO1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5
10	P69849	9.5	30.0	1222	0.103	0.020	NOMO3_HUMAN BOS complex subunit NOMO3 OS=Homo sapiens OX=9606 GN=NOMO3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13620 CarboxypepD_reg	72	15.1	Carboxypeptidase regulatory-like domain
2	PF09430 EMC7_beta-sandw	1.8e-31	120.2	ER membrane protein complex subunit 7, beta-sandwich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267750	0.999	ER membrane protein complex subunit 4
2	9606.ENSP00000306220	0.999	Membrane magnesium transporter 1
3	9606.ENSP00000334037	0.999	ER membrane protein complex subunit 10
4	9606.ENSP00000220853	0.998	ER membrane protein complex subunit 2
5	9606.ENSP00000245046	0.998	ER membrane protein complex subunit 3
6	9606.ENSP00000253457	0.998	ER membrane protein complex subunit 8
7	9606.ENSP00000403210	0.998	ER membrane protein complex subunit 9
8	9606.ENSP00000420608	0.998	ER membrane protein complex subunit 1
9	9606.ENSP00000380322	0.996	ER membrane protein complex subunit 6
10	9606.ENSP00000469240	0.830	Charged multivesicular body protein 2a
11	9606.ENSP00000357507	0.807	Uncharacterized protein C1orf43
12	9606.ENSP00000362334	0.801	Proteasome subunit beta type-2
13	9606.ENSP00000290541	0.776	Proteasome subunit beta type-4
14	9606.ENSP00000386557	0.766	Uncharacterized membrane protein C19orf24
15	9606.ENSP00000386186	0.759	Tigger transposable element-derived protein 1
16	9606.ENSP00000215829	0.737	Small nuclear ribonucleoprotein Sm D3
17	9606.ENSP00000380872	0.737	piggyBac transposable element derived 4
18	9606.ENSP00000256319	0.732	Probable ergosterol biosynthetic protein 28
19	9606.ENSP00000258416	0.714	Eukaryotic translation initiation factor 4E type 2
20	9606.ENSP00000256433	0.699	Immediate early response 3-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032977	1.000	membrane insertase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.849	cellular component organization
GO:0051234	0.829	establishment of localization
GO:0008104	0.826	protein localization
GO:0006996	0.817	organelle organization
GO:0061024	0.781	membrane organization
GO:0045184	0.743	establishment of protein localization
GO:0010256	0.723	endomembrane system organization
GO:0045048	0.677	protein insertion into ER membrane
GO:0045050	0.398	protein insertion into ER membrane by stop-transfer membrane-anchor sequence
GO:0071816	0.371	tail-anchored membrane protein insertion into ER membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0072546	0.996	EMC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]