StarFunc result for job id Q9NPA8

User Input

>input (101 residues)
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLE
HVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9D9	0.988	0.988	1.254E-13	101	1.000	1.000	A0A024R9D9.pdb.gz
2	PDB:4dhxC	0.867	0.938	6.850E-12	93	0.901	0.978	4dhxC.pdb.gz
3	AFDB:E5RHX8	0.711	0.717	2.633E-8	100	0.713	0.720	E5RHX8.pdb.gz	E5RHX8_HUMAN Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1
4	AFDB:Q6NQ54	0.916	0.808	3.399E-8	115	0.525	0.461	Q6NQ54.pdb.gz	ENY2_ARATH Transcription and mRNA export factor ENY2 OS=Arabidopsis thaliana OX=3702 GN=ENY2 PE=1 SV=1
5	AFDB:Q9VYX1	0.740	0.740	4.632E-6	101	0.406	0.406	Q9VYX1.pdb.gz	ENY2_DROME Enhancer of yellow 2 transcription factor OS=Drosophila melanogaster OX=7227 GN=e(y)2 PE=1 SV=1
6	AFDB:Q7LL15	0.758	0.712	5.212E-4	108	0.267	0.250	Q7LL15.pdb.gz	SUS1_SCHPO Transcription and mRNA export factor sus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sus1 PE=3 SV=1
7	AFDB:Q6WNK7	0.779	0.817	7.172E-4	96	0.267	0.281	Q6WNK7.pdb.gz	SUS1_YEAST Transcription and mRNA export factor SUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUS1 PE=1 SV=1
8	PDB:4wa6B	0.732	0.766	1.098E-3	96	0.267	0.281	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
9	AFDB:B3H7K2	0.413	0.391	4.018E-3	107	0.297	0.280	B3H7K2.pdb.gz	B3H7K2_ARATH Transcription/mRNA export factor OS=Arabidopsis thaliana OX=3702 GN=ENY2 PE=1 SV=2
10	AFDB:Q22056	0.788	0.810	6.664E-2	98	0.168	0.173	Q22056.pdb.gz	Q22056_CAEEL Transcription and mRNA export factor ENY2 OS=Caenorhabditis elegans OX=6239 GN=CELE_T01C3.2 PE=1 SV=2
11	AFDB:B5G0E7	0.310	0.298	2.533	108	0.168	0.157	B5G0E7.pdb.gz	B5G0E7_TAEGU Tubulin-specific chaperone A OS=Taeniopygia guttata OX=59729 GN=TBCA PE=2 SV=1
12	PDB:1h7cA	0.249	0.245	2.645	103	0.188	0.184	1h7cA.pdb.gz
13	AFDB:Q9VA16	0.242	0.070	2.878	529	0.198	0.038	Q9VA16.pdb.gz	Q9VA16_DROME Sox100B protein OS=Drosophila melanogaster OX=7227 GN=Sox100B PE=2 SV=3
14	PDB:6z6oC	0.256	0.074	3.203	548	0.139	0.026	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
15	PDB:1u2mC	0.269	0.205	3.414	143	0.109	0.077	1u2mC.pdb.gz
16	PDB:6o6pA	0.264	0.148	4.135	188	0.079	0.043	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
17	PDB:1qsdA	0.235	0.234	4.698	102	0.188	0.186	1qsdA.pdb.gz
18	PDB:7ehlA	0.185	0.045	4.698	563	0.109	0.020	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
19	PDB:4dk0A	0.268	0.118	6.064	324	0.168	0.052	4dk0A.pdb.gz
20	PDB:7msct	0.253	0.284	6.064	85	0.149	0.176	7msct.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPA8	4.22e-69	203	101	1.000	1.000	ENY2_HUMAN Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1
2	D3ZWF5	1.07e-67	199	100	0.980	0.990	D3ZWF5_RAT Transcription and mRNA export factor ENY2 OS=Rattus norvegicus OX=10116 GN=Eny2 PE=1 SV=2
3	A0A8I5ZVD6	1.43e-67	199	105	0.980	0.943	A0A8I5ZVD6_RAT Transcription and mRNA export factor ENY2 OS=Rattus norvegicus OX=10116 GN=Eny2 PE=1 SV=1
4	A0A8I5ZLL7	2.16e-65	194	96	0.950	1.000	A0A8I5ZLL7_RAT Transcription and mRNA export factor ENY2 OS=Rattus norvegicus OX=10116 GN=Eny2 PE=3 SV=1
5	E5RHX8	1.34e-46	146	100	0.723	0.730	E5RHX8_HUMAN Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1
6	Q6NQ54	4.38e-31	107	115	0.495	0.435	ENY2_ARATH Transcription and mRNA export factor ENY2 OS=Arabidopsis thaliana OX=3702 GN=ENY2 PE=1 SV=1
7	Q9VYX1	4.17e-26	94.7	101	0.406	0.406	ENY2_DROME Enhancer of yellow 2 transcription factor OS=Drosophila melanogaster OX=7227 GN=e(y)2 PE=1 SV=1
8	B3H7K2	2.29e-13	62.4	107	0.257	0.243	B3H7K2_ARATH Transcription/mRNA export factor OS=Arabidopsis thaliana OX=3702 GN=ENY2 PE=1 SV=2
9	Q6WNK7	1.08e-09	52.8	96	0.267	0.281	SUS1_YEAST Transcription and mRNA export factor SUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUS1 PE=1 SV=1
10	Q7LL15	1.69e-07	47.4	108	0.257	0.241	SUS1_SCHPO Transcription and mRNA export factor sus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sus1 PE=3 SV=1
11	Q38D54	0.80	30.4	305	0.188	0.062	Q38D54_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4540 PE=4 SV=1
12	B1ARD8	1.4	30.0	910	0.178	0.020	SLFN8_MOUSE Schlafen family member 8 OS=Mus musculus OX=10090 GN=Slfn8 PE=2 SV=1
13	B1ARD6	2.8	28.9	910	0.178	0.020	SLFN9_MOUSE Schlafen family member 9 OS=Mus musculus OX=10090 GN=Slfn9 PE=2 SV=1
14	Q9VBY6	4.0	28.5	231	0.119	0.052	Q9VBY6_DROME LD40504p OS=Drosophila melanogaster OX=7227 GN=PQBP1 PE=2 SV=1
15	A0A1D8PRR9	4.6	28.5	1079	0.158	0.015	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1
16	Q9XWX6	9.0	27.3	244	0.168	0.070	Q9XWX6_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10163 EnY2	2.5e-31	119.1	Transcription factor e(y)2
2	PF10057 MpsC	1.3e+02	14.1	Na+-translocating membrane potential-generating system (MpsC)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008849718.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008838688.1	0.996	Minichromosome maintenance complex component 3 associated protein
2	1026970.XP_008836386.1	0.995	Ataxin 7 like 3
3	1026970.XP_008846646.1	0.980	PCI domain-containing protein 2
4	1026970.XP_008853071.1	0.977	Transcriptional adapter 3 isoform X1
5	1026970.XP_008820161.1	0.972	Ubiquitin carboxyl-terminal hydrolase 22
6	1026970.XP_008852034.1	0.971	Transcriptional adaptor 2B
7	1026970.XP_008833507.1	0.970	Histone acetyltransferase KAT2A isoform X1
8	1026970.XP_008827575.1	0.961	Centrin-3
9	1026970.XP_008846309.1	0.957	Transcriptional adaptor 2A
10	1026970.XP_008840837.1	0.956	Ubiquitin specific peptidase 27, X-linked
11	1026970.XP_008831385.1	0.953	Histone acetyltransferase KAT2B
12	1026970.XP_008822151.1	0.949	SAGA-associated factor 29 homolog
13	1026970.XP_008822250.1	0.949	Transformation/transcription domain-associated protein isoform X1
14	1026970.XP_008835639.1	0.942	TATA-box binding protein associated factor 10
15	1026970.XP_008827724.1	0.940	Centrin-2 isoform X1
16	1026970.XP_008837070.1	0.940	TATA-box binding protein associated factor 9
17	1026970.XP_008837110.1	0.933	SAC3 domain-containing protein 1
18	1026970.XP_008835881.1	0.927	TATA-box binding protein associated factor 9b
19	1026970.XP_008846460.1	0.922	Transcriptional adapter 1 isoform X1
20	1026970.XP_008845792.1	0.912	E3 SUMO-protein ligase RanBP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030374	0.999	nuclear receptor coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0048519	0.984	negative regulation of biological process
GO:0048523	0.950	negative regulation of cellular process
GO:0048583	0.934	regulation of response to stimulus
GO:0050796	0.930	regulation of insulin secretion
GO:0051051	0.925	negative regulation of transport
GO:0050709	0.907	negative regulation of protein secretion
GO:0090278	0.907	negative regulation of peptide hormone secretion
GO:0061178	0.853	regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0009987	0.847	cellular process
GO:0046676	0.810	negative regulation of insulin secretion
GO:0048585	0.785	negative regulation of response to stimulus
GO:0008152	0.775	metabolic process
GO:0071704	0.738	organic substance metabolic process
GO:0043170	0.731	macromolecule metabolic process
GO:0051171	0.713	regulation of nitrogen compound metabolic process
GO:0060255	0.708	regulation of macromolecule metabolic process
GO:0080090	0.707	regulation of primary metabolic process
GO:0031323	0.694	regulation of cellular metabolic process
GO:0010468	0.666	regulation of gene expression
GO:0044238	0.654	primary metabolic process
GO:0006807	0.634	nitrogen compound metabolic process
GO:0019219	0.634	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.569	regulation of biosynthetic process
GO:0048518	0.565	positive regulation of biological process
GO:0031326	0.552	regulation of cellular biosynthetic process
GO:0051252	0.552	regulation of RNA metabolic process
GO:0010556	0.548	regulation of macromolecule biosynthetic process
GO:0048522	0.534	positive regulation of cellular process
GO:1901564	0.421	organonitrogen compound metabolic process
GO:0006355	0.387	regulation of DNA-templated transcription
GO:0019538	0.345	protein metabolic process
GO:0010467	0.338	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005739	0.976	mitochondrion
GO:0032991	0.964	protein-containing complex
GO:0043232	0.925	intracellular non-membrane-bounded organelle
GO:0012505	0.876	endomembrane system
GO:1902494	0.810	catalytic complex
GO:0140513	0.801	nuclear protein-containing complex
GO:0005694	0.737	chromosome
GO:0140535	0.676	intracellular protein-containing complex
GO:0000785	0.623	chromatin
GO:1990234	0.621	transferase complex
GO:1905368	0.618	peptidase complex
GO:0000124	0.595	SAGA complex
GO:0031967	0.592	organelle envelope
GO:0005635	0.452	nuclear envelope
GO:0005643	0.316	nuclear pore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]