StarFunc result for job id Q9NPB1

User Input

>input (228 residues)
MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRAR
FPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMAS
LQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDI
TGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPB1	1.000	1.000	3.217E-50	228	1.000	1.000	Q9NPB1.pdb.gz	NT5M_HUMAN 5'(3')-deoxyribonucleotidase, mitochondrial OS=Homo sapiens OX=9606 GN=NT5M PE=1 SV=1
2	AFDB:Q8VCE6	0.874	0.905	5.745E-44	220	0.842	0.873	Q8VCE6.pdb.gz	NT5M_MOUSE 5'(3')-deoxyribonucleotidase, mitochondrial OS=Mus musculus OX=10090 GN=Nt5m PE=1 SV=1
3	AFDB:Q8TCD5	0.843	0.956	1.327E-34	201	0.522	0.592	Q8TCD5.pdb.gz	NT5C_HUMAN 5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=2
4	PDB:2jaoA	0.839	0.974	2.059E-34	196	0.509	0.592	2jaoA.pdb.gz	Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
5	AFDB:Q9JM14	0.848	0.965	8.090E-34	200	0.518	0.590	Q9JM14.pdb.gz	NT5C_MOUSE 5'(3')-deoxyribonucleotidase, cytosolic type OS=Mus musculus OX=10090 GN=Nt5c PE=1 SV=1
6	PDB:2i7dA	0.837	0.987	7.649E-33	193	0.522	0.617	2i7dA.pdb.gz	Structures of Human and Murine cytosolic deoxyribonucleotidase: Insights into substrate specificity and catalysis
7	AFDB:J3KRC4	0.698	0.871	1.508E-25	182	0.417	0.522	J3KRC4.pdb.gz	J3KRC4_HUMAN 5', 3'-nucleotidase, cytosolic OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
8	AFDB:J3KSX6	0.450	0.669	4.138E-17	153	0.390	0.582	J3KSX6.pdb.gz	J3KSX6_HUMAN 5', 3'-nucleotidase, cytosolic (Fragment) OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
9	AFDB:F4JTE7	0.420	0.337	2.029E-5	298	0.162	0.124	F4JTE7.pdb.gz	GPP1_ARATH (DL)-glycerol-3-phosphatase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GPP1 PE=1 SV=1
10	PDB:1te2A	0.408	0.425	2.767E-5	218	0.149	0.156	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
11	AFDB:Q94K71	0.455	0.349	3.870E-5	319	0.184	0.132	Q94K71.pdb.gz	CBBY_ARATH CBBY-like protein OS=Arabidopsis thaliana OX=3702 GN=CBBY PE=1 SV=1
12	PDB:4uauA	0.459	0.462	4.946E-5	226	0.149	0.150	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
13	AFDB:Q8VZP1	0.502	0.481	7.872E-5	240	0.180	0.171	Q8VZP1.pdb.gz	GPP2_ARATH (DL)-glycerol-3-phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=GPP2 PE=1 SV=1
14	PDB:3l5kA	0.498	0.489	9.433E-5	233	0.149	0.146	3l5kA.pdb.gz
15	AFDB:P77247	0.409	0.418	9.554E-5	222	0.149	0.153	P77247.pdb.gz	HXPB_ECOLI Hexitol phosphatase B OS=Escherichia coli (strain K12) OX=83333 GN=hxpB PE=1 SV=1
16	PDB:2w4mA	0.464	0.428	1.919E-4	250	0.145	0.132	2w4mA.pdb.gz
17	PDB:1rkuA	0.406	0.439	5.053E-4	206	0.167	0.184	1rkuA.pdb.gz	The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
18	PDB:2qltA	0.379	0.354	2.230E-3	251	0.114	0.104	2qltA.pdb.gz	The crystal structure of an isoform of DL-glycerol-3-phosphatase, Rhr2p from Saccharomyces cerevisiae.
19	PDB:2g80A	0.268	0.272	3.738E-3	225	0.123	0.124	2g80A.pdb.gz	Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution
20	PDB:2b82A	0.414	0.442	3.987E-3	211	0.123	0.133	2b82A.pdb.gz	A structure-based proposal for the catalytic mechanism of the bacterial acid phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPB1	2.32e-170	469	228	1.000	1.000	NT5M_HUMAN 5'(3')-deoxyribonucleotidase, mitochondrial OS=Homo sapiens OX=9606 GN=NT5M PE=1 SV=1
2	Q8VCE6	6.91e-137	384	220	0.842	0.873	NT5M_MOUSE 5'(3')-deoxyribonucleotidase, mitochondrial OS=Mus musculus OX=10090 GN=Nt5m PE=1 SV=1
3	Q9JM14	3.10e-89	263	200	0.522	0.595	NT5C_MOUSE 5'(3')-deoxyribonucleotidase, cytosolic type OS=Mus musculus OX=10090 GN=Nt5c PE=1 SV=1
4	Q8TCD5	3.69e-87	258	201	0.522	0.592	NT5C_HUMAN 5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=2
5	V9HWF3	3.69e-87	258	201	0.522	0.592	V9HWF3_HUMAN Epididymis luminal protein 74 OS=Homo sapiens OX=9606 GN=HEL74 PE=2 SV=1
6	J3KRC4	3.34e-62	194	182	0.390	0.489	J3KRC4_HUMAN 5', 3'-nucleotidase, cytosolic OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
7	J3KSX6	2.70e-56	178	153	0.399	0.595	J3KSX6_HUMAN 5', 3'-nucleotidase, cytosolic (Fragment) OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
8	E2RK30	1.8	32.3	4074	0.075	0.004	PKHD1_CANLF Fibrocystin OS=Canis lupus familiaris OX=9615 GN=PKHD1 PE=3 SV=2
9	O14186	2.6	31.6	846	0.079	0.021	YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F8.11 PE=4 SV=1
10	B1AR69	3.0	31.6	1938	0.053	0.006	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	Q9UKX3	3.0	31.6	1938	0.053	0.006	MYH13_HUMAN Myosin-13 OS=Homo sapiens OX=9606 GN=MYH13 PE=2 SV=2
12	C1P640	4.4	31.2	3683	0.070	0.004	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
13	C1P641	4.4	31.2	3663	0.070	0.004	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
14	G5EEV6	4.4	31.2	3704	0.070	0.004	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
15	Q21313	4.4	31.2	3672	0.070	0.004	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
16	P48777	7.0	30.0	580	0.075	0.029	UAPC_EMENI Purine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uapC PE=2 SV=2
17	O13939	8.7	30.0	745	0.053	0.016	AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06941 NT5C	1.2e-21	88.9	5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371230	0.970	GTP:AMP phosphotransferase AK3, mitochondrial
2	9606.ENSP00000379038	0.970	Thymidine phosphorylase
3	9606.ENSP00000256722	0.951	UMP-CMP kinase 2, mitochondrial
4	9606.ENSP00000286648	0.949	Deoxycytidine kinase
5	9606.ENSP00000369456	0.949	Inosine triphosphate pyrophosphatase
6	9606.ENSP00000235628	0.948	Cytosolic 5'-nucleotidase 1A
7	9606.ENSP00000304802	0.947	Thymidylate kinase
8	9606.ENSP00000349576	0.942	Deoxycytidylate deaminase
9	9606.ENSP00000352904	0.938	Cytosolic 5'-nucleotidase 1B
10	9606.ENSP00000264093	0.931	Deoxyguanosine kinase, mitochondrial
11	9606.ENSP00000484415	0.931	Cytosolic 5'-nucleotidase 3A
12	9606.ENSP00000339479	0.922	Cytosolic purine 5'-nucleotidase
13	9606.ENSP00000389948	0.921	7-methylguanosine phosphate-specific 5'-nucleotidase
14	9606.ENSP00000232607	0.920	Uridine 5'-monophosphate synthase
15	9606.ENSP00000315644	0.920	Thymidylate synthase
16	9606.ENSP00000370376	0.915	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
17	9606.ENSP00000361965	0.914	Adenosine deaminase
18	9606.ENSP00000364212	0.913	Cytidine deaminase
19	9606.ENSP00000286621	0.909	Adenosine kinase
20	9606.ENSP00000236959	0.908	Bifunctional purine biosynthesis protein PURH

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008252	1.000	nucleotidase activity
GO:0008253	0.935	5'-nucleotidase activity
GO:0005488	0.678	binding
GO:0005515	0.612	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006139	0.988	nucleobase-containing compound metabolic process
GO:0044281	0.987	small molecule metabolic process
GO:0055086	0.982	nucleobase-containing small molecule metabolic process
GO:0019637	0.948	organophosphate metabolic process
GO:1901564	0.943	organonitrogen compound metabolic process
GO:0006796	0.941	phosphate-containing compound metabolic process
GO:0006753	0.922	nucleoside phosphate metabolic process
GO:0009117	0.909	nucleotide metabolic process
GO:1901135	0.907	carbohydrate derivative metabolic process
GO:1901565	0.768	organonitrogen compound catabolic process
GO:0006220	0.757	pyrimidine nucleotide metabolic process
GO:0009394	0.752	2'-deoxyribonucleotide metabolic process
GO:0034655	0.704	nucleobase-containing compound catabolic process
GO:0009219	0.662	pyrimidine deoxyribonucleotide metabolic process
GO:0072529	0.660	pyrimidine-containing compound catabolic process
GO:1901292	0.660	nucleoside phosphate catabolic process
GO:1901136	0.646	carbohydrate derivative catabolic process
GO:0009166	0.635	nucleotide catabolic process
GO:0009123	0.424	nucleoside monophosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005739	0.994	mitochondrion
GO:0005829	0.467	cytosol
GO:0005759	0.422	mitochondrial matrix
GO:0031981	0.335	nuclear lumen
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22140	1.000	a nucleoside 5'-phosphate + H2O = a nucleoside + phosphate
RHEA:12484	0.935	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	0.935	5'-nucleotidase.

[back to server]