StarFunc result for job id Q9NPB8

User Input

>input (672 residues)
MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSR
GVSVQYRYFKGYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
TLDSGWLTCQTEIRLRLHYSEKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPLPG
YSCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMN
LFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRS
RTTPIAMSFAQFENLLGINVHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKE
LGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGESDIH
VDANGIDNVENA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0L9	0.987	0.983	0.000	675	0.929	0.924	Q8C0L9.pdb.gz	GPCP1_MOUSE Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus OX=10090 GN=Gpcpd1 PE=1 SV=1
2	AFDB:Q86BI9	0.753	0.663	9.195E-55	770	0.268	0.234	Q86BI9.pdb.gz	Q86BI9_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=1
3	AFDB:Q02979	0.516	0.294	2.131E-33	1223	0.208	0.114	Q02979.pdb.gz	GDE1_YEAST Glycerophosphocholine phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDE1 PE=1 SV=1
4	AFDB:A0A1D8PNZ7	0.490	0.293	1.027E-30	1162	0.198	0.114	A0A1D8PNZ7.pdb.gz	GDE1_CANAL Glycerophosphocholine phosphodiesterase GDE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GDE1 PE=1 SV=1
5	AFDB:Q9C104	0.455	0.294	5.865E-28	1076	0.195	0.122	Q9C104.pdb.gz	GDE1_SCHPO Glycerophosphocholine phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gde1 PE=1 SV=1
6	AFDB:Q9SGA2	0.359	0.654	1.199E-20	361	0.121	0.224	Q9SGA2.pdb.gz	GDPD1_ARATH Glycerophosphodiester phosphodiesterase GDPD1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GDPD1 PE=1 SV=1
7	AFDB:Q9FLM1	0.367	0.642	1.996E-20	374	0.131	0.235	Q9FLM1.pdb.gz	GDPD2_ARATH Glycerophosphodiester phosphodiesterase GDPD2 OS=Arabidopsis thaliana OX=3702 GN=GDPD2 PE=2 SV=1
8	AFDB:P17442	0.402	0.240	3.395E-19	1178	0.132	0.076	P17442.pdb.gz	PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO81 PE=1 SV=2
9	AFDB:A0A1D8PRR1	0.403	0.216	1.164E-16	1330	0.143	0.072	A0A1D8PRR1.pdb.gz	A0A1D8PRR1_CANAL Pho81p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO81 PE=4 SV=1
10	AFDB:Q6FL30	0.409	0.252	2.725E-16	1137	0.104	0.062	Q6FL30.pdb.gz	Q6FL30_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PHO81 PE=4 SV=1
11	PDB:4rkkA	0.137	0.269	3.294E-5	317	0.045	0.095	4rkkA.pdb.gz	Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.
12	PDB:6kxkD	0.124	0.142	6.275E-4	553	0.080	0.098	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5jovA	0.160	0.121	1.741E-3	949	0.082	0.058	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
14	PDB:5a50A	0.103	0.310	2.588E-3	165	0.039	0.158	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:1ea9C	0.137	0.150	4.828E-3	583	0.061	0.070	1ea9C.pdb.gz
16	PDB:3ho8D	0.178	0.133	5.723E-3	934	0.051	0.036	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
17	PDB:4hnvB	0.171	0.117	6.056E-3	1033	0.052	0.034	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
18	PDB:7wtbB	0.225	0.143	1.067E-2	1147	0.091	0.053	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
19	PDB:7mpyB	0.167	0.234	1.265E-2	430	0.094	0.147	7mpyB.pdb.gz
20	PDB:4rj9A	0.123	0.396	1.500E-2	161	0.031	0.130	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C0L9	0.0	1274	675	0.927	0.923	GPCP1_MOUSE Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus OX=10090 GN=Gpcpd1 PE=1 SV=1
2	Q9VVV5	2.91e-64	226	653	0.199	0.205	Q9VVV5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=2
3	M9PI96	3.02e-64	226	649	0.199	0.206	M9PI96_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=1
4	Q9VVV6	3.06e-64	226	636	0.199	0.211	Q9VVV6_DROME LD45843p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=2
5	Q86BJ0	1.44e-63	226	711	0.199	0.188	Q86BJ0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=1
6	Q86BI9	2.20e-63	226	770	0.199	0.174	Q86BI9_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=1
7	A0A1D8PNZ7	4.21e-41	163	1162	0.177	0.102	GDE1_CANAL Glycerophosphocholine phosphodiesterase GDE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GDE1 PE=1 SV=1
8	Q9C104	2.55e-31	133	1076	0.149	0.093	GDE1_SCHPO Glycerophosphocholine phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gde1 PE=1 SV=1
9	Q02979	1.92e-26	118	1223	0.103	0.056	GDE1_YEAST Glycerophosphocholine phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDE1 PE=1 SV=1
10	Q9SGA2	1.08e-20	96.7	361	0.124	0.230	GDPD1_ARATH Glycerophosphodiester phosphodiesterase GDPD1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GDPD1 PE=1 SV=1
11	Q9FLM1	1.09e-20	96.7	374	0.126	0.227	GDPD2_ARATH Glycerophosphodiester phosphodiesterase GDPD2 OS=Arabidopsis thaliana OX=3702 GN=GDPD2 PE=2 SV=1
12	P36914	1.96e-06	53.5	612	0.039	0.042	AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=glaA PE=2 SV=2
13	Q9ESM6	9.68e-05	47.8	539	0.100	0.124	GDPD2_MOUSE Glycerophosphoinositol inositolphosphodiesterase GDPD2 OS=Mus musculus OX=10090 GN=Gdpd2 PE=1 SV=1
14	Q9JL55	0.001	44.3	331	0.037	0.076	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
15	Q9JL56	0.001	44.3	331	0.037	0.076	GDE1_MOUSE Glycerophosphodiester phosphodiesterase 1 OS=Mus musculus OX=10090 GN=Gde1 PE=1 SV=1
16	Q9NZC3	0.001	43.9	331	0.036	0.073	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
17	Q57YK9	0.003	42.7	333	0.049	0.099	Q57YK9_TRYB2 GP-PDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.720 PE=4 SV=1
18	P69328	0.004	42.7	640	0.030	0.031	AMYG_ASPNG Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
19	G5EAT0	0.013	41.2	623	0.034	0.037	G5EAT0_EMENI alpha-amylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03402 PE=3 SV=1
20	Q8IM31	0.016	40.8	475	0.031	0.044	Q8IM31_PLAF7 Glycerophosphodiester phosphodiesterase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1406300 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00686 CBM_20	5.3e-08	43.9	Starch binding domain
2	PF03009 GDPD	9.3e-58	207.6	Glycerophosphoryl diester phosphodiesterase family
3	PF00388 PI-PLC-X	2.7e+02	12.6	Phosphatidylinositol-specific phospholipase C, X domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265689	0.962	Choline kinase alpha
2	9606.ENSP00000384400	0.943	Choline/ethanolamine kinase
3	9606.ENSP00000384610	0.942	Patatin-like phospholipase domain-containing protein 7
4	9606.ENSP00000407509	0.942	Neuropathy target esterase
5	9606.ENSP00000266517	0.932	Ethanolamine kinase 1
6	9606.ENSP00000363638	0.920	Acyl-protein thioesterase 2
7	9606.ENSP00000320043	0.916	Acyl-protein thioesterase 1
8	9606.ENSP00000356169	0.912	Ethanolamine kinase 2
9	9606.ENSP00000406909	0.910	Phosphoethanolamine/phosphocholine phosphatase
10	9606.ENSP00000337103	0.905	Choline O-acetyltransferase
11	9606.ENSP00000219345	0.903	Group XV phospholipase A2
12	9606.ENSP00000303211	0.902	Acetylcholinesterase
13	9606.ENSP00000330442	0.900	Phospholipase B1, membrane-associated
14	9606.ENSP00000246024	0.726	Thioredoxin related transmembrane protein 4
15	9606.ENSP00000203001	0.719	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
16	9606.ENSP00000261637	0.718	Small subunit processome component 20 homolog
17	9606.ENSP00000337972	0.695	Glycerophosphodiester phosphodiesterase domain-containing protein 5
18	9606.ENSP00000217289	0.685	Fermitin family homolog 1
19	9606.ENSP00000368066	0.684	Hydroxyacid oxidase 1
20	9606.ENSP00000368164	0.676	DNA helicase MCM8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008081	1.000	phosphoric diester hydrolase activity
GO:0008889	0.969	glycerophosphodiester phosphodiesterase activity
GO:0047389	0.944	glycerophosphocholine phosphodiesterase activity
GO:0005488	0.930	binding
GO:0005515	0.914	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.912	developmental process
GO:0007517	0.887	muscle organ development
GO:0060538	0.778	skeletal muscle organ development
GO:0007519	0.767	skeletal muscle tissue development
GO:0008152	0.511	metabolic process
GO:0009987	0.415	cellular process
GO:0071704	0.396	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.956	membrane-bounded organelle
GO:0043229	0.847	intracellular organelle
GO:0043231	0.830	intracellular membrane-bounded organelle
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.
RHEA:12969	0.969	a sn-glycero-3-phosphodiester + H2O = an alcohol + H(+) + sn-glycerol 3-phosphate
EC:3.1.4.46	0.969	glycerophosphodiester phosphodiesterase.
RHEA:16061	0.944	H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate
EC:3.1.4.2	0.944	glycerophosphocholine phosphodiesterase.

[back to server]