StarFunc result for job id Q9NPC4

User Input

>input (353 residues)
MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIP
CPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGG
NASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRI
ALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDH
YNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDIN
PEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPC4	1.000	1.000	2.036E-76	353	1.000	1.000	Q9NPC4.pdb.gz	A4GAT_HUMAN Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
2	AFDB:Q9JI93	0.880	0.864	4.597E-62	360	0.802	0.786	Q9JI93.pdb.gz	A4GAT_RAT Lactosylceramide 4-alpha-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=A4galt PE=1 SV=1
3	AFDB:Q9UNA3	0.708	0.735	4.498E-31	340	0.317	0.329	Q9UNA3.pdb.gz	A4GCT_HUMAN Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
4	AFDB:Q14BT6	0.720	0.744	1.700E-30	341	0.320	0.331	Q14BT6.pdb.gz	A4GCT_MOUSE Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1
5	AFDB:Q9VBL5	0.698	0.626	1.759E-26	395	0.266	0.238	Q9VBL5.pdb.gz	Q9VBL5_DROME Alpha1,4-galactosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=alpha4GT2 PE=3 SV=3
6	AFDB:Q9VQK4	0.719	0.689	1.548E-25	369	0.297	0.285	Q9VQK4.pdb.gz	Q9VQK4_DROME Alpha1,4-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=alpha4GT1 PE=2 SV=1
7	AFDB:O14084	0.433	0.475	3.895E-9	319	0.122	0.135	O14084.pdb.gz	IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
8	AFDB:A0A1D8PIF7	0.429	0.290	2.693E-8	544	0.119	0.077	A0A1D8PIF7.pdb.gz	A0A1D8PIF7_CANAL Mannosylinositol phosphorylceramide synthase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIT1 PE=3 SV=1
9	AFDB:C4ULG3	0.421	0.080	4.366E-8	2123	0.116	0.019	C4ULG3.pdb.gz	AFP18_YERRA Toxin Afp18 OS=Yersinia ruckeri serotype O1 (strain ATCC 29473 / DSM 18506 / JCM 15110 / NCIMB 2194 / NCTC 12986 / 2396-61) OX=527005 GN=afp18 PE=1 SV=1
10	AFDB:O15488	0.430	0.324	4.638E-8	501	0.156	0.110	O15488.pdb.gz	GLYG2_HUMAN Glycogenin-2 OS=Homo sapiens OX=9606 GN=GYG2 PE=1 SV=2
11	PDB:8cvzI	0.435	0.540	8.976E-7	267	0.119	0.157	8cvzI.pdb.gz
12	PDB:1ll0B	0.466	0.584	1.370E-6	267	0.108	0.142	1ll0B.pdb.gz
13	PDB:4y63A	0.305	0.366	4.810E-4	282	0.099	0.124	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
14	PDB:6aguA	0.329	0.373	5.428E-4	304	0.099	0.115	6aguA.pdb.gz
15	PDB:6aciA	0.308	0.352	9.932E-4	304	0.105	0.122	6aciA.pdb.gz	Structural and Functional Insights into Host Death Domains Inactivation by the Bacterial Arginine GlcNAcyltransferase Effector.
16	PDB:2janA	0.194	0.172	5.393E-3	419	0.125	0.105	2janA.pdb.gz
17	PDB:5vcmB	0.288	0.285	5.729E-3	358	0.102	0.101	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
18	PDB:3ts1A	0.193	0.210	6.464E-3	317	0.105	0.117	3ts1A.pdb.gz	Structure of tyrosyl-tRNA synthetase refined at 2.3 A resolution. Interaction of the enzyme with the tyrosyl adenylate intermediate.
19	PDB:5vcsB	0.296	0.317	1.183E-2	323	0.110	0.121	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
20	PDB:6oq5A	0.247	0.041	2.164E-2	2346	0.068	0.010	6oq5A.pdb.gz	Structure of the full-length Clostridium difficile toxin B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q67BJ4	0.0	568	359	0.773	0.760	A4GAT_MOUSE Lactosylceramide 4-alpha-galactosyltransferase OS=Mus musculus OX=10090 GN=A4galt PE=2 SV=1
2	Q9JI93	0.0	590	360	0.802	0.786	A4GAT_RAT Lactosylceramide 4-alpha-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=A4galt PE=1 SV=1
3	Q9NPC4	0.0	733	353	1.000	1.000	A4GAT_HUMAN Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
4	Q14BT6	2.83e-63	206	341	0.309	0.320	A4GCT_MOUSE Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1
5	Q9UNA3	1.74e-62	204	340	0.314	0.326	A4GCT_HUMAN Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
6	Q9VQK4	9.87e-46	162	369	0.317	0.304	Q9VQK4_DROME Alpha1,4-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=alpha4GT1 PE=2 SV=1
7	Q6KCK5	8.28e-44	156	357	0.312	0.308	Q6KCK5_DROME Alpha1,4-N-acetylgalactosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=alpha4GT1 PE=2 SV=1
8	Q9VBL5	1.25e-34	132	395	0.269	0.241	Q9VBL5_DROME Alpha1,4-galactosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=alpha4GT2 PE=3 SV=3
9	O14196	0.52	34.3	300	0.156	0.183	MU165_SCHPO Meiotically up-regulated gene 165 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug165 PE=1 SV=1
10	P38287	1.1	33.5	376	0.093	0.088	CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
11	Q46149	1.2	33.9	2178	0.059	0.010	TCDA_CLONO Toxin A OS=Clostridium novyi OX=1542 GN=tcdA PE=1 SV=1
12	Q10323	2.6	32.3	356	0.082	0.081	IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
13	Q54L90	3.8	32.0	1601	0.051	0.011	GFLB_DICDI Ras guanine nucleotide exchange factor glfB OS=Dictyostelium discoideum OX=44689 GN=gflB PE=1 SV=1
14	Q550K8	4.8	32.0	2454	0.037	0.005	Y7071_DICDI Probable serine/threonine-protein kinase DDB_G0277071 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277071 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04572 Gb3_synth	9.1e-43	157.0	Alpha 1,4-glycosyltransferase conserved region
2	PF04488 Gly_transf_sug	7e-17	73.2	Glycosyltransferase sugar-binding region containing DXD motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376532	0.990	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
2	9606.ENSP00000306459	0.957	Beta-1,4-galactosyltransferase 6
3	9606.ENSP00000369055	0.946	Beta-1,4-galactosyltransferase 1
4	9606.ENSP00000218516	0.928	Galactosidase alpha
5	9606.ENSP00000420161	0.924	Beta-1,4-galactosyltransferase 4
6	9606.ENSP00000310696	0.921	Beta-1,4-galactosyltransferase 2
7	9606.ENSP00000480428	0.920	Beta-1,4-galactosyltransferase 3
8	9606.ENSP00000268097	0.904	Beta-hexosaminidase subunit alpha
9	9606.ENSP00000261416	0.902	Beta-hexosaminidase subunit beta
10	9606.ENSP00000306920	0.818	Beta-galactosidase
11	9606.ENSP00000376178	0.776	Syntaxin-2
12	9606.ENSP00000390784	0.764	Beta-1,3-galactosyltransferase 4
13	9606.ENSP00000356404	0.741	Beta-1,3-galactosyltransferase 2
14	9606.ENSP00000376456	0.737	Beta-1,3-galactosyltransferase 1
15	9606.ENSP00000215095	0.735	Syntaxin-1B
16	9606.ENSP00000379310	0.713	Protein phosphatase 1 regulatory subunits
17	9606.ENSP00000363397	0.698	Ceramide glucosyltransferase
18	9606.ENSP00000475261	0.691	Alpha-1,3-galactosyltransferase 2
19	9606.ENSP00000377700	0.690	TBC1 domain family member 23
20	9606.ENSP00000269373	0.678	Ketosamine-3-kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008378	1.000	galactosyltransferase activity
GO:0008194	0.962	UDP-glycosyltransferase activity
GO:0005488	0.604	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.856	organic substance metabolic process
GO:0044238	0.850	primary metabolic process
GO:0006807	0.840	nitrogen compound metabolic process
GO:1901564	0.816	organonitrogen compound metabolic process
GO:0044237	0.798	cellular metabolic process
GO:0010256	0.785	endomembrane system organization
GO:1901135	0.712	carbohydrate derivative metabolic process
GO:1901576	0.691	organic substance biosynthetic process
GO:0044249	0.681	cellular biosynthetic process
GO:1901566	0.667	organonitrogen compound biosynthetic process
GO:1901137	0.647	carbohydrate derivative biosynthetic process
GO:0061024	0.628	membrane organization
GO:0007009	0.583	plasma membrane organization
GO:0006643	0.438	membrane lipid metabolic process
GO:0006665	0.402	sphingolipid metabolic process
GO:0006664	0.381	glycolipid metabolic process
GO:0006687	0.321	glycosphingolipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.976	endomembrane system
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0005737	0.952	cytoplasm
GO:0005794	0.900	Golgi apparatus
GO:0031090	0.897	organelle membrane
GO:0098588	0.875	bounding membrane of organelle
GO:0000139	0.645	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]