StarFunc result for job id Q9NPC6

User Input

>input (264 residues)
MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKM
RQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNP
DNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELP
DYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWI
SENIPIVITTEPTDDTTVPESEDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPC6	1.000	1.000	6.263E-43	264	1.000	1.000	Q9NPC6.pdb.gz	MYOZ2_HUMAN Myozenin-2 OS=Homo sapiens OX=9606 GN=MYOZ2 PE=1 SV=1
2	AFDB:Q9JJW5	0.716	0.716	2.007E-34	264	0.883	0.883	Q9JJW5.pdb.gz	MYOZ2_MOUSE Myozenin-2 OS=Mus musculus OX=10090 GN=Myoz2 PE=1 SV=1
3	AFDB:Q9NP98	0.230	0.209	3.542E-10	299	0.345	0.304	Q9NP98.pdb.gz	MYOZ1_HUMAN Myozenin-1 OS=Homo sapiens OX=9606 GN=MYOZ1 PE=1 SV=1
4	AFDB:Q8R4E4	0.186	0.200	7.496E-9	245	0.299	0.322	Q8R4E4.pdb.gz	MYOZ3_MOUSE Myozenin-3 OS=Mus musculus OX=10090 GN=Myoz3 PE=1 SV=1
5	AFDB:Q8TDC0	0.198	0.207	1.170E-8	251	0.337	0.355	Q8TDC0.pdb.gz	MYOZ3_HUMAN Myozenin-3 OS=Homo sapiens OX=9606 GN=MYOZ3 PE=1 SV=2
6	AFDB:A0A024R2J4	0.096	0.087	2.011E-1	292	0.159	0.144	A0A024R2J4.pdb.gz
7	AFDB:A0A286Y962	0.110	0.060	3.345E-1	650	0.106	0.043	A0A286Y962.pdb.gz	A0A286Y962_DANRE Potassium voltage-gated channel subfamily D member 3 isoform X1 OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=4 SV=1
8	AFDB:P20396	0.099	0.106	3.565E-1	242	0.159	0.174	P20396.pdb.gz	TRH_HUMAN Pro-thyrotropin-releasing hormone OS=Homo sapiens OX=9606 GN=TRH PE=1 SV=1
9	AFDB:Q8VHQ3	0.099	0.056	5.221E-1	568	0.159	0.074	Q8VHQ3.pdb.gz	PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1
10	AFDB:Q2VIQ3	0.118	0.034	5.929E-1	1234	0.148	0.032	Q2VIQ3.pdb.gz	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
11	PDB:4n78F	0.108	0.161	6.489	156	0.072	0.122	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:7r5jV0	0.086	0.084	7.853	273	0.121	0.117	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:7btbX	0.079	0.120	8.368	141	0.053	0.099	7btbX.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:7wi3B	0.090	0.087	8.368	275	0.061	0.058	7wi3B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPC6	0.0	545	264	1.000	1.000	MYOZ2_HUMAN Myozenin-2 OS=Homo sapiens OX=9606 GN=MYOZ2 PE=1 SV=1
2	Q9JJW5	1.45e-180	498	264	0.883	0.883	MYOZ2_MOUSE Myozenin-2 OS=Mus musculus OX=10090 GN=Myoz2 PE=1 SV=1
3	Q8TDC0	1.11e-30	116	251	0.345	0.363	MYOZ3_HUMAN Myozenin-3 OS=Homo sapiens OX=9606 GN=MYOZ3 PE=1 SV=2
4	Q8R4E4	9.86e-30	114	245	0.326	0.351	MYOZ3_MOUSE Myozenin-3 OS=Mus musculus OX=10090 GN=Myoz3 PE=1 SV=1
5	Q9NP98	5.02e-20	89.4	299	0.189	0.167	MYOZ1_HUMAN Myozenin-1 OS=Homo sapiens OX=9606 GN=MYOZ1 PE=1 SV=1
6	Q9JK37	1.38e-18	85.1	296	0.182	0.162	MYOZ1_MOUSE Myozenin-1 OS=Mus musculus OX=10090 GN=Myoz1 PE=1 SV=1
7	Q8CC35	0.40	34.7	929	0.080	0.023	SYNPO_MOUSE Synaptopodin OS=Mus musculus OX=10090 GN=Synpo PE=1 SV=2
8	Q9Z327	0.40	34.7	931	0.080	0.023	SYNPO_RAT Synaptopodin OS=Rattus norvegicus OX=10116 GN=Synpo PE=1 SV=2
9	B4DLE4	0.65	33.9	698	0.057	0.021	B4DLE4_HUMAN cDNA FLJ54419, highly similar to Synaptopodin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
10	Q9UMS6	0.71	33.9	1093	0.057	0.014	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
11	H0Y9Y3	0.98	33.5	1155	0.057	0.013	H0Y9Y3_HUMAN Synaptopodin 2 (Fragment) OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=1
12	B8A4W9	4.6	31.2	807	0.076	0.025	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
13	Q91YE8	5.0	31.2	1087	0.061	0.015	SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus OX=10090 GN=Synpo2 PE=1 SV=2
14	P29536	5.7	30.8	600	0.076	0.033	LMOD1_HUMAN Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=3
15	D4A702	6.1	30.8	1262	0.061	0.013	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
16	Q9CYD3	7.7	30.4	400	0.072	0.048	CRTAP_MOUSE Cartilage-associated protein OS=Mus musculus OX=10090 GN=Crtap PE=1 SV=3
17	Q8BWB1	9.6	30.0	975	0.045	0.012	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
18	G3G960	9.7	30.4	3095	0.061	0.005	G3G960_9ALPH VP1/2 OS=Suid alphaherpesvirus 1 OX=10345 GN=UL36 PE=3 SV=1
19	Q8N3V7	9.9	30.0	929	0.045	0.013	SYNPO_HUMAN Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO PE=1 SV=2
20	A0A2R8RTS6	10.0	30.0	879	0.102	0.031	A0A2R8RTS6_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05556 Calsarcin	9.9e-86	299.0	Calcineurin-binding protein (Calsarcin)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312624	0.962	Telethonin
2	9606.ENSP00000401437	0.959	LIM domain-binding protein 3
3	9606.ENSP00000443495	0.948	Alpha-actinin-2
4	9606.ENSP00000431813	0.909	Cysteine and glycine-rich protein 3
5	9606.ENSP00000377941	0.896	Alpha-actinin-1
6	9606.ENSP00000467141	0.866	Titin
7	9606.ENSP00000262113	0.852	Myomesin-2
8	9606.ENSP00000252699	0.849	Alpha-actinin-4
9	9606.ENSP00000442795	0.822	Myosin-binding protein C, cardiac-type
10	9606.ENSP00000261448	0.819	Calsequestrin-2
11	9606.ENSP00000368808	0.819	Small muscular protein
12	9606.ENSP00000480359	0.817	PDZ and LIM domain protein 5
13	9606.ENSP00000411932	0.802	Leiomodin-2
14	9606.ENSP00000341940	0.800	Caveolin-3
15	9606.ENSP00000394770	0.778	Cardiomyopathy-associated protein 5
16	9606.ENSP00000380489	0.774	Myoglobin
17	9606.ENSP00000379210	0.768	Myosin light chain 3
18	9606.ENSP00000239926	0.752	Myotilin
19	9606.ENSP00000327145	0.752	Filamin-C
20	9606.ENSP00000228841	0.733	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0031433	0.418	telethonin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0032501	0.978	multicellular organismal process
GO:0048523	0.974	negative regulation of cellular process
GO:0003012	0.969	muscle system process
GO:0048856	0.947	anatomical structure development
GO:0009888	0.932	tissue development
GO:0050896	0.931	response to stimulus
GO:0007517	0.931	muscle organ development
GO:0048869	0.915	cellular developmental process
GO:0010927	0.902	cellular component assembly involved in morphogenesis
GO:0030029	0.897	actin filament-based process
GO:0055001	0.895	muscle cell development
GO:0030239	0.889	myofibril assembly
GO:0019222	0.813	regulation of metabolic process
GO:0060255	0.801	regulation of macromolecule metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0031323	0.772	regulation of cellular metabolic process
GO:0051171	0.746	regulation of nitrogen compound metabolic process
GO:0048583	0.726	regulation of response to stimulus
GO:0060537	0.618	muscle tissue development
GO:0010646	0.573	regulation of cell communication
GO:0023051	0.522	regulation of signaling
GO:1902531	0.467	regulation of intracellular signal transduction
GO:0045214	0.464	sarcomere organization
GO:0031326	0.462	regulation of cellular biosynthetic process
GO:0010556	0.458	regulation of macromolecule biosynthetic process
GO:0009892	0.443	negative regulation of metabolic process
GO:0010468	0.430	regulation of gene expression
GO:0019219	0.394	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.383	cellular response to stimulus
GO:0051172	0.383	negative regulation of nitrogen compound metabolic process
GO:0006355	0.378	regulation of DNA-templated transcription
GO:0010605	0.377	negative regulation of macromolecule metabolic process
GO:0031324	0.371	negative regulation of cellular metabolic process
GO:0009890	0.350	negative regulation of biosynthetic process
GO:0050848	0.348	regulation of calcium-mediated signaling
GO:0023057	0.316	negative regulation of signaling
GO:0010648	0.315	negative regulation of cell communication
GO:1902532	0.311	negative regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	0.999	sarcomere
GO:0005856	0.838	cytoskeleton
GO:0015629	0.809	actin cytoskeleton
GO:0005829	0.756	cytosol
GO:0030018	0.535	Z disc
GO:0043231	0.392	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]