StarFunc result for job id Q9NPF4

User Input

>input (335 residues)
MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEA
LTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLI
TGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNI
EQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAM
LVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIA
QAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPF4	1.000	1.000	4.301E-70	335	1.000	1.000	Q9NPF4.pdb.gz	OSGEP_HUMAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1
2	PDB:6gwjK	0.992	0.995	2.075E-64	334	0.997	1.000	6gwjK.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
3	AFDB:Q9VV41	0.987	0.953	4.574E-56	347	0.722	0.697	Q9VV41.pdb.gz	OSGEP_DROME Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Drosophila melanogaster OX=7227 GN=Tcs3 PE=2 SV=1
4	AFDB:O49653	0.990	0.940	4.746E-55	353	0.699	0.663	O49653.pdb.gz	O49653_ARATH Glycoprotease 2 OS=Arabidopsis thaliana OX=3702 GN=GCP2 PE=1 SV=1
5	AFDB:O94637	0.986	0.955	6.065E-53	346	0.651	0.630	O94637.pdb.gz	KAE1_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgp2 PE=3 SV=1
6	AFDB:P36132	0.974	0.847	7.596E-50	386	0.660	0.573	P36132.pdb.gz	KAE1_YEAST tRNA N6-adenosine threonylcarbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAE1 PE=1 SV=2
7	AFDB:Q9UXT7	0.940	0.971	5.452E-42	324	0.466	0.481	Q9UXT7.pdb.gz	KAE1_PYRAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=kae1 PE=1 SV=1
8	PDB:2ivnA	0.935	0.963	2.593E-41	325	0.466	0.480	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
9	AFDB:Q8IJ99	0.915	0.520	1.015E-35	598	0.475	0.266	Q8IJ99.pdb.gz	Q8IJ99_PLAF7 N(6)-L-threonylcarbamoyladenine synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1030600 PE=3 SV=1
10	AFDB:E2QE90	0.895	0.890	4.200E-29	337	0.340	0.338	E2QE90.pdb.gz	E2QE90_ECOLX tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli OX=562 GN=tsaD PE=3 SV=1
11	AFDB:O05518	0.901	0.874	8.819E-29	346	0.328	0.318	O05518.pdb.gz	TSAD_BACSU tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tsaD PE=1 SV=1
12	PDB:6z81A	0.904	0.886	9.873E-28	342	0.337	0.330	6z81A.pdb.gz	Structure of a reaction intermediate mimic in t6A biosynthesis bound in the active site of the TsaBD heterodimer from Escherichia coli.
13	AFDB:P9WHT7	0.909	0.886	6.609E-26	344	0.299	0.291	P9WHT7.pdb.gz	TSAD_MYCTU tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsaD PE=1 SV=1
14	PDB:4k25A	0.781	0.741	2.181E-21	355	0.257	0.242	4k25A.pdb.gz	Reconstitution and characterization of eukaryotic N6-threonylcarbamoylation of tRNA using a minimal enzyme system.
15	PDB:4ehtA	0.539	0.650	8.472E-9	268	0.125	0.157	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
16	PDB:3venA	0.615	0.384	1.127E-8	571	0.173	0.102	3venA.pdb.gz	The O-Carbamoyltransferase TobZ Catalyzes an Ancient Enzymatic Reaction.
17	PDB:4yduC	0.333	0.465	1.337E-8	230	0.131	0.191	4yduC.pdb.gz	The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
18	PDB:7p7wBBB	0.431	0.464	2.319E-7	306	0.125	0.137	7p7wBBB.pdb.gz	Structure and function of N-acetylglucosamine kinase illuminates the catalytic mechanism of ROK kinases
19	PDB:3vgkB	0.415	0.439	4.104E-7	312	0.125	0.135	3vgkB.pdb.gz	Substrate recognition mechanism and substrate-dependent conformational changes of an ROK family glucokinase from Streptomyces griseus
20	PDB:1c0gA	0.400	0.372	6.478E-7	368	0.128	0.117	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPF4	0.0	694	335	1.000	1.000	OSGEP_HUMAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1
2	Q9VV41	0.0	511	347	0.722	0.697	OSGEP_DROME Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Drosophila melanogaster OX=7227 GN=Tcs3 PE=2 SV=1
3	O49653	8.05e-179	500	353	0.699	0.663	O49653_ARATH Glycoprotease 2 OS=Arabidopsis thaliana OX=3702 GN=GCP2 PE=1 SV=1
4	O94637	2.19e-162	459	346	0.651	0.630	KAE1_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgp2 PE=3 SV=1
5	P36132	5.52e-152	434	386	0.675	0.585	KAE1_YEAST tRNA N6-adenosine threonylcarbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAE1 PE=1 SV=2
6	Q9UXT7	8.05e-105	311	324	0.472	0.488	KAE1_PYRAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=kae1 PE=1 SV=1
7	G3V445	1.60e-102	299	149	0.445	1.000	G3V445_HUMAN N(6)-L-threonylcarbamoyladenine synthase (Fragment) OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=8
8	Q8IJ99	5.16e-63	212	598	0.322	0.181	Q8IJ99_PLAF7 N(6)-L-threonylcarbamoyladenine synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1030600 PE=3 SV=1
9	O05518	3.14e-46	162	346	0.337	0.327	TSAD_BACSU tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tsaD PE=1 SV=1
10	E2QE90	3.28e-45	159	337	0.349	0.347	E2QE90_ECOLX tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli OX=562 GN=tsaD PE=3 SV=1
11	P05852	3.28e-45	159	337	0.349	0.347	TSAD_ECOLI tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=tsaD PE=1 SV=2
12	Q72B00	1.51e-32	126	361	0.299	0.277	TSAD_DESVH tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=tsaD PE=1 SV=1
13	Q9H4B0	3.48e-27	112	414	0.299	0.242	OSGL1_HUMAN tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=2
14	Q6PEB4	2.03e-25	107	414	0.299	0.242	OSGL1_MOUSE tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Osgepl1 PE=1 SV=2
15	O22145	5.02e-25	107	480	0.299	0.208	OSGP2_ARATH Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GCP1 PE=2 SV=2
16	P43122	1.40e-24	105	407	0.322	0.265	QRI7_YEAST tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI7 PE=1 SV=1
17	P9WHT7	2.17e-24	103	344	0.290	0.282	TSAD_MYCTU tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsaD PE=1 SV=1
18	O94710	3.49e-16	80.9	412	0.290	0.235	QRI7_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgp1 PE=3 SV=1
19	E7EVL7	1.71e-13	70.9	222	0.173	0.261	E7EVL7_HUMAN N(6)-L-threonylcarbamoyladenine synthase (Fragment) OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=1
20	E5RIL9	1.89e-11	64.7	203	0.161	0.266	E5RIL9_HUMAN N(6)-L-threonylcarbamoyladenine synthase (Fragment) OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02543 Carbam_trans_N	5.4e+02	11.4	Carbamoyltransferase N-terminus
2	PF00814 TsaD	4.3e-85	297.3	tRNA N6-adenosine threonylcarbamoyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000206542

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272424	0.999	EKC/KEOPS complex subunit TPRKB
2	9606.ENSP00000306320	0.999	EKC/KEOPS complex subunit GON7
3	9606.ENSP00000349923	0.999	EKC/KEOPS complex subunit LAGE3
4	9606.ENSP00000361186	0.999	TP53-regulating kinase
5	9606.ENSP00000479964	0.950	Kanadaptin
6	9606.ENSP00000362135	0.941	YrdC domain-containing protein, mitochondrial
7	9606.ENSP00000296420	0.929	Endomucin
8	9606.ENSP00000377700	0.838	TBC1 domain family member 23
9	9606.ENSP00000342262	0.812	Nucleoporin Nup43
10	9606.ENSP00000357633	0.800	Glutaredoxin-3
11	9606.ENSP00000445675	0.781	Melanoma antigen preferentially expressed in tumors
12	9606.ENSP00000229239	0.774	Glyceraldehyde-3-phosphate dehydrogenase
13	9606.ENSP00000355890	0.752	Bifunctional glutamate/proline--tRNA ligase
14	9606.ENSP00000388996	0.729	AP-1 complex subunit mu-1
15	9606.ENSP00000216714	0.726	DNA-(apurinic or apyrimidinic site) lyase
16	9606.ENSP00000264151	0.714	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
17	9606.ENSP00000280772	0.698	Ankyrin-3
18	9606.ENSP00000451818	0.694	Signal recognition particle 54 kDa protein
19	9606.ENSP00000355011	0.687	Interleukin enhancer-binding factor 2
20	9606.ENSP00000371110	0.683	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.376	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:1901360	0.987	organic cyclic compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0006725	0.987	cellular aromatic compound metabolic process
GO:0008033	0.966	tRNA processing
GO:0006400	0.941	tRNA modification
GO:0065007	0.532	biological regulation
GO:0050789	0.500	regulation of biological process
GO:0050794	0.407	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.999	intracellular organelle lumen
GO:0032991	0.996	protein-containing complex
GO:0005654	0.993	nucleoplasm
GO:0016020	0.986	membrane
GO:0005886	0.954	plasma membrane
GO:0005829	0.848	cytosol
GO:0000408	0.756	EKC/KEOPS complex
GO:0016604	0.693	nuclear body
GO:0016607	0.368	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]