StarFunc result for job id Q9NPF5

User Input

>input (467 residues)
MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYAL
LYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEE
GKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDH
QQFKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAGHERRRKEQLERLYNRTPEQ
VAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAE
KPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEEL
VHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAE
PAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q568Y6	0.660	0.659	1.117E-70	468	0.985	0.983	Q568Y6.pdb.gz	Q568Y6_RAT DNA methyltransferase 1-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dmap1 PE=1 SV=1
2	AFDB:B8JI50	0.679	0.683	5.338E-60	464	0.797	0.802	B8JI50.pdb.gz
3	AFDB:Q7K3D8	0.523	0.557	4.578E-39	433	0.441	0.476	Q7K3D8.pdb.gz	DMAP1_DROME DNA methyltransferase 1-associated protein 1 OS=Drosophila melanogaster OX=7227 GN=DMAP1 PE=1 SV=1
4	AFDB:A8XQE0	0.574	0.552	9.757E-30	488	0.355	0.340	A8XQE0.pdb.gz	A8XQE0_CAEEL SANT_DAMP1_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ekl-4 PE=1 SV=1
5	AFDB:O14308	0.365	0.389	1.558E-21	437	0.276	0.295	O14308.pdb.gz	SWC4_SCHPO SWR1-complex protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swc4 PE=3 SV=2
6	AFDB:Q8VZL6	0.364	0.384	3.696E-21	441	0.285	0.302	Q8VZL6.pdb.gz	SWC4_ARATH SWR1-complex protein 4 OS=Arabidopsis thaliana OX=3702 GN=SWC4 PE=1 SV=1
7	PDB:8escS	0.268	0.426	1.615E-10	268	0.146	0.254	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
8	AFDB:Q5AAJ7	0.226	0.170	1.983E-9	635	0.208	0.153	Q5AAJ7.pdb.gz	SWC4_CANAL SWR1-complex protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SWC4 PE=3 SV=1
9	AFDB:Q59E36	0.095	0.077	1.585E-2	590	0.128	0.102	Q59E36.pdb.gz	RCOR_DROME REST corepressor OS=Drosophila melanogaster OX=7227 GN=CoRest PE=1 SV=2
10	AFDB:P25357	0.137	0.070	3.550E-2	1226	0.143	0.055	P25357.pdb.gz	SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNT1 PE=1 SV=2
11	AFDB:F1QB13	0.100	0.061	4.219E-2	803	0.156	0.091	F1QB13.pdb.gz	F1QB13_DANRE GLIS family zinc finger 3 OS=Danio rerio OX=7955 GN=wu:fa55a05 PE=3 SV=1
12	PDB:6id0L	0.104	0.103	5.773E-2	475	0.090	0.088	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:6qdvO	0.100	0.106	1.628E-1	441	0.107	0.113	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
14	PDB:5yzgL	0.101	0.112	2.733E-1	419	0.096	0.107	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:6iczL	0.101	0.103	5.150E-1	454	0.084	0.086	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:3j6bT	0.067	0.117	7.276E-1	209	0.069	0.153	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:5gm6c	0.092	0.101	9.160E-1	415	0.092	0.104	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:5mqfL	0.100	0.126	1.371	336	0.081	0.113	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
19	PDB:7f3fA	0.078	0.079	1.828	460	0.047	0.048	7f3fA.pdb.gz
20	PDB:5z56L	0.101	0.136	1.937	342	0.079	0.108	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A1B5	0.0	827	436	0.893	0.956	A0A8I6A1B5_RAT DNA methyltransferase 1-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dmap1 PE=1 SV=1
2	Q568Y6	0.0	938	468	0.985	0.983	Q568Y6_RAT DNA methyltransferase 1-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dmap1 PE=1 SV=1
3	Q7ZUN3	0.0	721	464	0.756	0.761	Q7ZUN3_DANRE DNA methyltransferase 1-associated protein 1 OS=Danio rerio OX=7955 GN=zgc:55593 PE=1 SV=1
4	Q9JI44	0.0	934	468	0.981	0.979	DMAP1_MOUSE DNA methyltransferase 1-associated protein 1 OS=Mus musculus OX=10090 GN=Dmap1 PE=1 SV=1
5	Q9NPF5	0.0	957	467	1.000	1.000	DMAP1_HUMAN DNA methyltransferase 1-associated protein 1 OS=Homo sapiens OX=9606 GN=DMAP1 PE=1 SV=1
6	Q7K3D8	2.37e-136	401	433	0.439	0.473	DMAP1_DROME DNA methyltransferase 1-associated protein 1 OS=Drosophila melanogaster OX=7227 GN=DMAP1 PE=1 SV=1
7	A8XQE0	4.21e-88	279	488	0.319	0.305	A8XQE0_CAEEL SANT_DAMP1_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ekl-4 PE=1 SV=1
8	Q8VZL6	8.03e-43	159	441	0.274	0.290	SWC4_ARATH SWR1-complex protein 4 OS=Arabidopsis thaliana OX=3702 GN=SWC4 PE=1 SV=1
9	O14308	1.46e-38	147	437	0.212	0.227	SWC4_SCHPO SWR1-complex protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swc4 PE=3 SV=2
10	P53201	4.17e-20	95.1	476	0.163	0.160	SWC4_YEAST SWR1-complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWC4 PE=1 SV=1
11	Q5AAJ7	4.09e-15	80.1	635	0.101	0.074	SWC4_CANAL SWR1-complex protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SWC4 PE=3 SV=1
12	Q9BI21	0.33	36.2	1197	0.066	0.026	Q9BI21_DROME Putative helicase Ski2 OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=1
13	Q9VCH8	0.33	36.2	1197	0.066	0.026	Q9VCH8_DROME LD23303p OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=2
14	Q4WEY8	2.9	32.7	342	0.073	0.099	HACA_ASPFU Transcriptional regulator of the unfolded protein response hacA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hacA PE=3 SV=2
15	Q679P3	9.7	31.2	416	0.039	0.043	PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus OX=9031 GN=PDLIM7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05499 DMAP1	3.7e-71	249.8	DNA methyltransferase 1-associated protein 1 (DMAP1)
2	PF16282 SANT_DAMP1_like	1.2e-29	113.7	SANT/Myb-like domain of DAMP1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016981

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004637	0.996	YEATS domain containing 4
2	61853.ENSNLEP00000017307	0.994	RuvB-like helicase
3	61853.ENSNLEP00000012065	0.993	MRG/MORF4L binding protein
4	61853.ENSNLEP00000005920	0.992	RuvB-like helicase
5	61853.ENSNLEP00000012347	0.991	Vacuolar protein sorting 72 homolog (S. cerevisiae)
6	61853.ENSNLEP00000010671	0.990	Mortality factor 4 like 1
7	61853.ENSNLEP00000007058	0.989	K(lysine) acetyltransferase 5
8	61853.ENSNLEP00000014063	0.988	MYST/Esa1-associated factor 6
9	61853.ENSNLEP00000010409	0.987	E1A binding protein p400
10	61853.ENSNLEP00000019381	0.987	Snf2-related CREBBP activator protein
11	61853.ENSNLEP00000022030	0.985	Enhancer of polycomb homolog 1 (Drosophila)
12	61853.ENSNLEP00000007474	0.984	ARP6 actin-related protein 6 homolog (yeast)
13	61853.ENSNLEP00000007056	0.983	Actin-like 6A
14	61853.ENSNLEP00000015813	0.983	Craniofacial development protein 1
15	61853.ENSNLEP00000010052	0.982	Zinc finger, HIT-type containing 1
16	61853.ENSNLEP00000011131	0.980	Enhancer of polycomb homolog 2 (Drosophila)
17	61853.ENSNLEP00000014469	0.978	Actin-like 6B
18	61853.ENSNLEP00000014397	0.968	Inhibitor of growth family, member 3
19	61853.ENSNLEP00000007350	0.965	YEATS domain containing 2
20	61853.ENSNLEP00000010657	0.958	Bromodomain containing 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.999	transcription factor binding
GO:0140297	0.908	DNA-binding transcription factor binding
GO:0061629	0.848	RNA polymerase II-specific DNA-binding transcription factor binding
GO:1901363	0.809	heterocyclic compound binding
GO:0097159	0.809	organic cyclic compound binding
GO:0003712	0.796	transcription coregulator activity
GO:0003676	0.758	nucleic acid binding
GO:0003824	0.742	catalytic activity
GO:0003677	0.598	DNA binding
GO:0003714	0.429	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.965	organic substance metabolic process
GO:0044238	0.958	primary metabolic process
GO:0006807	0.957	nitrogen compound metabolic process
GO:0031326	0.930	regulation of cellular biosynthetic process
GO:0010468	0.922	regulation of gene expression
GO:0043170	0.921	macromolecule metabolic process
GO:0009987	0.911	cellular process
GO:0051252	0.898	regulation of RNA metabolic process
GO:0010556	0.896	regulation of macromolecule biosynthetic process
GO:1903506	0.890	regulation of nucleic acid-templated transcription
GO:0048518	0.889	positive regulation of biological process
GO:0048522	0.855	positive regulation of cellular process
GO:0006355	0.850	regulation of DNA-templated transcription
GO:0009893	0.805	positive regulation of metabolic process
GO:0010604	0.804	positive regulation of macromolecule metabolic process
GO:0050896	0.794	response to stimulus
GO:0009890	0.777	negative regulation of biosynthetic process
GO:0016570	0.774	histone modification
GO:0051173	0.727	positive regulation of nitrogen compound metabolic process
GO:0010605	0.723	negative regulation of macromolecule metabolic process
GO:0031325	0.717	positive regulation of cellular metabolic process
GO:0010558	0.713	negative regulation of macromolecule biosynthetic process
GO:0051253	0.712	negative regulation of RNA metabolic process
GO:0045935	0.670	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.658	regulation of transcription by RNA polymerase II
GO:0048583	0.655	regulation of response to stimulus
GO:0042221	0.588	response to chemical
GO:0016573	0.576	histone acetylation
GO:0031327	0.575	negative regulation of cellular biosynthetic process
GO:0044237	0.541	cellular metabolic process
GO:0051052	0.526	regulation of DNA metabolic process
GO:0010033	0.434	response to organic substance
GO:0048584	0.418	positive regulation of response to stimulus
GO:0080134	0.402	regulation of response to stress
GO:0071840	0.399	cellular component organization or biogenesis
GO:1901700	0.394	response to oxygen-containing compound
GO:0043967	0.390	histone H4 acetylation
GO:2001020	0.382	regulation of response to DNA damage stimulus
GO:0016043	0.362	cellular component organization
GO:0045892	0.343	negative regulation of DNA-templated transcription
GO:2001022	0.335	positive regulation of response to DNA damage stimulus
GO:0006282	0.331	regulation of DNA repair
GO:0051726	0.316	regulation of cell cycle
GO:2000779	0.313	regulation of double-strand break repair
GO:0051054	0.311	positive regulation of DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0032991	0.998	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0005829	0.993	cytosol
GO:0000123	0.986	histone acetyltransferase complex
GO:1902562	0.846	H4 histone acetyltransferase complex
GO:0032993	0.797	protein-DNA complex
GO:0044815	0.787	DNA packaging complex
GO:0043189	0.779	H4/H2A histone acetyltransferase complex
GO:0035267	0.767	NuA4 histone acetyltransferase complex
GO:0000786	0.512	nucleosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]