StarFunc result for job id Q9NPF7

User Input

>input (189 residues)
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPF7	1.000	1.000	7.469E-28	189	1.000	1.000	Q9NPF7.pdb.gz	IL23A_HUMAN Interleukin-23 subunit alpha OS=Homo sapiens OX=9606 GN=IL23A PE=1 SV=1
2	PDB:5mj4B	0.818	0.950	5.949E-21	162	0.857	1.000	5mj4B.pdb.gz
3	AFDB:Q9EQ14	0.889	0.859	4.045E-20	196	0.746	0.719	Q9EQ14.pdb.gz	IL23A_MOUSE Interleukin-23 subunit alpha OS=Mus musculus OX=10090 GN=Il23a PE=1 SV=1
4	PDB:3qwrB	0.687	0.910	3.046E-16	141	0.741	0.993	3qwrB.pdb.gz
5	PDB:3duhC	0.673	0.919	2.586E-15	137	0.720	0.993	3duhC.pdb.gz
6	AFDB:P05231	0.594	0.537	6.435E-4	212	0.159	0.142	P05231.pdb.gz	IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 PE=1 SV=1
7	AFDB:Q90YI0	0.600	0.482	1.291E-3	241	0.201	0.158	Q90YI0.pdb.gz	IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 PE=2 SV=1
8	AFDB:P26893	0.611	0.552	2.020E-3	212	0.201	0.179	P26893.pdb.gz	IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE=2 SV=2
9	PDB:4cniC	0.511	0.558	2.652E-3	171	0.148	0.164	4cniC.pdb.gz
10	AFDB:P20607	0.597	0.540	3.492E-3	211	0.196	0.175	P20607.pdb.gz	IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 GN=Il6 PE=2 SV=1
11	AFDB:P08505	0.602	0.547	4.946E-3	211	0.185	0.166	P08505.pdb.gz	IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=Il6 PE=1 SV=1
12	AFDB:M5EF24	0.467	0.414	6.035E-3	219	0.217	0.187	M5EF24.pdb.gz	M5EF24_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=8022 GN=IL6 PE=3 SV=1
13	AFDB:P09920	0.573	0.526	7.006E-3	208	0.201	0.183	P09920.pdb.gz	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
14	AFDB:P97712	0.586	0.524	1.096E-2	214	0.175	0.154	P97712.pdb.gz	P97712_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=2 SV=1
15	PDB:4zs7A	0.514	0.679	1.179E-2	139	0.159	0.216	4zs7A.pdb.gz
16	PDB:3hmxB	0.497	0.529	6.725E-2	176	0.159	0.170	3hmxB.pdb.gz
17	PDB:1cnt2	0.436	0.612	9.525E-2	130	0.090	0.131	1cnt2.pdb.gz
18	PDB:7zxkC	0.537	0.602	1.162E-1	166	0.164	0.187	7zxkC.pdb.gz
19	PDB:7u7nD	0.556	0.551	1.730E-1	191	0.169	0.168	7u7nD.pdb.gz
20	PDB:1cnt1	0.471	0.580	2.009E-1	150	0.090	0.113	1cnt1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPF7	1.47e-136	380	189	1.000	1.000	IL23A_HUMAN Interleukin-23 subunit alpha OS=Homo sapiens OX=9606 GN=IL23A PE=1 SV=1
2	Q9EQ14	2.36e-88	259	196	0.746	0.719	IL23A_MOUSE Interleukin-23 subunit alpha OS=Mus musculus OX=10090 GN=Il23a PE=1 SV=1
3	Q38A34	0.11	35.0	393	0.079	0.038	SPS2_TRYB2 Selenide, water dikinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SPS2 PE=1 SV=1
4	Q9C9S0	0.19	34.7	530	0.101	0.036	Q9C9S0_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TPR12 PE=1 SV=1
5	A0A0N7F297	2.1	31.2	519	0.132	0.048	C82D6_SINHE Demethylepipodophyllotoxin synthase OS=Sinopodophyllum hexandrum OX=93608 GN=CYP82D61 PE=1 SV=1
6	P08505	2.9	30.4	211	0.101	0.090	IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=Il6 PE=1 SV=1
7	Q54UN7	9.1	29.6	1049	0.101	0.018	Q54UN7_DICDI Phox domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280921 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16649 IL23	3.5e-97	334.4	Interleukin 23 subunit alpha
2	PF00489 IL6	2.7e+02	12.5	Interleukin-6/G-CSF/MGF family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228534

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231228	0.998	Interleukin-12 subunit beta
2	9606.ENSP00000321345	0.998	Interleukin-23 receptor
3	9606.ENSP00000470788	0.992	Interleukin-12 receptor subunit beta-1
4	9606.ENSP00000344192	0.980	Interleukin-17A
5	9606.ENSP00000337432	0.969	Interleukin-17F
6	9606.ENSP00000385675	0.968	Interleukin-6
7	9606.ENSP00000412237	0.964	Interleukin-10
8	9606.ENSP00000264657	0.953	Signal transducer and activator of transcription 3
9	9606.ENSP00000354394	0.943	Signal transducer and activator of transcription 1-alpha/beta
10	9606.ENSP00000376134	0.937	Signal transducer and activator of transcription 4
11	9606.ENSP00000431885	0.934	Non-receptor tyrosine-protein kinase TYK2
12	9606.ENSP00000384273	0.931	Transcription factor p65
13	9606.ENSP00000371067	0.930	Tyrosine-protein kinase JAK2
14	9606.ENSP00000384906	0.926	Serum amyloid A-1 protein
15	9606.ENSP00000330341	0.925	Suppressor of cytokine signaling 3
16	9606.ENSP00000341208	0.925	Signal transducer and activator of transcription 5A
17	9606.ENSP00000362108	0.925	Neutrophil gelatinase-associated lipocalin
18	9606.ENSP00000216797	0.924	NF-kappa-B inhibitor alpha
19	9606.ENSP00000361405	0.922	Matrix metalloproteinase-9
20	9606.ENSP00000215781	0.915	Oncostatin-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045519	1.000	interleukin-23 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.992	positive regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0048583	0.985	regulation of response to stimulus
GO:0010604	0.985	positive regulation of macromolecule metabolic process
GO:0051239	0.981	regulation of multicellular organismal process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0048584	0.977	positive regulation of response to stimulus
GO:0080090	0.970	regulation of primary metabolic process
GO:0048519	0.966	negative regulation of biological process
GO:0023051	0.966	regulation of signaling
GO:0010646	0.966	regulation of cell communication
GO:0051240	0.966	positive regulation of multicellular organismal process
GO:0032103	0.963	positive regulation of response to external stimulus
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0002684	0.957	positive regulation of immune system process
GO:0030155	0.955	regulation of cell adhesion
GO:0002831	0.952	regulation of response to biotic stimulus
GO:0009987	0.942	cellular process
GO:0002696	0.942	positive regulation of leukocyte activation
GO:0001819	0.941	positive regulation of cytokine production
GO:0031325	0.940	positive regulation of cellular metabolic process
GO:0045785	0.939	positive regulation of cell adhesion
GO:0009966	0.937	regulation of signal transduction
GO:1903037	0.935	regulation of leukocyte cell-cell adhesion
GO:0031347	0.934	regulation of defense response
GO:0022409	0.931	positive regulation of cell-cell adhesion
GO:0042129	0.931	regulation of T cell proliferation
GO:0050778	0.930	positive regulation of immune response
GO:0002697	0.928	regulation of immune effector process
GO:0050671	0.927	positive regulation of lymphocyte proliferation
GO:0050793	0.919	regulation of developmental process
GO:0001934	0.919	positive regulation of protein phosphorylation
GO:0009605	0.917	response to external stimulus
GO:1903039	0.916	positive regulation of leukocyte cell-cell adhesion
GO:0050870	0.913	positive regulation of T cell activation
GO:0009967	0.909	positive regulation of signal transduction
GO:0045595	0.907	regulation of cell differentiation
GO:0050691	0.905	regulation of defense response to virus by host
GO:0044093	0.899	positive regulation of molecular function
GO:0002230	0.898	positive regulation of defense response to virus by host
GO:0044419	0.895	biological process involved in interspecies interaction between organisms
GO:0051707	0.892	response to other organism
GO:0051094	0.891	positive regulation of developmental process
GO:2000026	0.889	regulation of multicellular organismal development
GO:1902533	0.885	positive regulation of intracellular signal transduction
GO:0042102	0.881	positive regulation of T cell proliferation
GO:0006952	0.870	defense response
GO:0045597	0.865	positive regulation of cell differentiation
GO:1903706	0.861	regulation of hemopoiesis
GO:0046634	0.846	regulation of alpha-beta T cell activation
GO:0050731	0.846	positive regulation of peptidyl-tyrosine phosphorylation
GO:1903708	0.844	positive regulation of hemopoiesis
GO:0002821	0.839	positive regulation of adaptive immune response
GO:1902105	0.836	regulation of leukocyte differentiation
GO:0009889	0.835	regulation of biosynthetic process
GO:1902107	0.828	positive regulation of leukocyte differentiation
GO:0002822	0.826	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002824	0.822	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051716	0.808	cellular response to stimulus
GO:0045935	0.802	positive regulation of nucleobase-containing compound metabolic process
GO:0023052	0.798	signaling
GO:0042531	0.789	positive regulation of tyrosine phosphorylation of STAT protein
GO:0042221	0.788	response to chemical
GO:0009617	0.788	response to bacterium
GO:0007154	0.769	cell communication
GO:0009892	0.765	negative regulation of metabolic process
GO:0045637	0.762	regulation of myeloid cell differentiation
GO:0007165	0.759	signal transduction
GO:0048523	0.742	negative regulation of cellular process
GO:0070887	0.741	cellular response to chemical stimulus
GO:0045639	0.738	positive regulation of myeloid cell differentiation
GO:0098542	0.704	defense response to other organism
GO:0010605	0.688	negative regulation of macromolecule metabolic process
GO:0031326	0.657	regulation of cellular biosynthetic process
GO:0010556	0.656	regulation of macromolecule biosynthetic process
GO:0010033	0.642	response to organic substance
GO:0002376	0.640	immune system process
GO:2001141	0.631	regulation of RNA biosynthetic process
GO:1904892	0.627	regulation of receptor signaling pathway via STAT
GO:0006355	0.613	regulation of DNA-templated transcription
GO:1904894	0.579	positive regulation of receptor signaling pathway via STAT
GO:0032501	0.575	multicellular organismal process
GO:0007166	0.561	cell surface receptor signaling pathway
GO:0071310	0.512	cellular response to organic substance
GO:0071345	0.494	cellular response to cytokine stimulus
GO:0009891	0.470	positive regulation of biosynthetic process
GO:0051241	0.464	negative regulation of multicellular organismal process
GO:0032502	0.449	developmental process
GO:0048856	0.443	anatomical structure development
GO:0046635	0.438	positive regulation of alpha-beta T cell activation
GO:0006955	0.436	immune response
GO:0019221	0.364	cytokine-mediated signaling pathway
GO:0010629	0.362	negative regulation of gene expression
GO:0031328	0.348	positive regulation of cellular biosynthetic process
GO:0045321	0.311	leukocyte activation
GO:0010557	0.303	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005615	0.996	extracellular space
GO:0012505	0.995	endomembrane system
GO:0070013	0.995	intracellular organelle lumen
GO:0005737	0.988	cytoplasm
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0071944	0.852	cell periphery
GO:0016020	0.791	membrane
GO:0005886	0.747	plasma membrane
GO:0070743	0.721	interleukin-23 complex
GO:0005783	0.687	endoplasmic reticulum
GO:0031982	0.385	vesicle
GO:0005788	0.385	endoplasmic reticulum lumen
GO:0031981	0.344	nuclear lumen
GO:0005654	0.318	nucleoplasm
GO:0031410	0.307	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]