StarFunc result for job id Q9NPG1

User Input

>input (666 residues)
MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61086	0.798	0.798	3.253E-90	666	0.980	0.980	Q61086.pdb.gz	FZD3_MOUSE Frizzled-3 OS=Mus musculus OX=10090 GN=Fzd3 PE=1 SV=1
2	AFDB:O42579	0.602	0.603	9.053E-82	664	0.884	0.887	O42579.pdb.gz	FZD3_XENLA Frizzled-3 OS=Xenopus laevis OX=8355 GN=fzd3 PE=1 SV=1
3	AFDB:Q5TZ38	0.650	0.634	2.947E-75	685	0.763	0.742	Q5TZ38.pdb.gz	Q5TZ38_DANRE Frizzled class receptor 3a OS=Danio rerio OX=7955 GN=fzd3 PE=2 SV=1
4	AFDB:B1WB86	0.575	0.600	3.498E-69	637	0.691	0.722	B1WB86.pdb.gz
5	AFDB:Q8WMU5	0.591	0.554	7.592E-59	712	0.535	0.500	Q8WMU5.pdb.gz	FZD6_CANLF Frizzled-6 OS=Canis lupus familiaris OX=9615 GN=FZD6 PE=2 SV=1
6	AFDB:Q61089	0.666	0.629	2.321E-55	709	0.511	0.480	Q61089.pdb.gz	FZD6_MOUSE Frizzled-6 OS=Mus musculus OX=10090 GN=Fzd6 PE=1 SV=1
7	AFDB:Q6NV44	0.526	0.624	1.022E-46	559	0.359	0.428	Q6NV44.pdb.gz	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
8	AFDB:O75084	0.534	0.619	1.228E-46	574	0.362	0.420	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
9	AFDB:Q9PUK8	0.535	0.646	1.475E-46	549	0.356	0.432	Q9PUK8.pdb.gz	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
10	AFDB:Q9UP38	0.534	0.549	1.772E-46	647	0.365	0.376	Q9UP38.pdb.gz	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
11	PDB:7evwR	0.471	0.896	3.017E-24	340	0.266	0.521	7evwR.pdb.gz
12	PDB:7e32R	0.294	0.614	1.051E-5	285	0.063	0.147	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:6wwzR	0.328	0.620	2.753E-5	310	0.062	0.132	6wwzR.pdb.gz
14	PDB:7td3R	0.264	0.536	4.559E-5	292	0.066	0.151	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
15	PDB:4xesA	0.222	0.291	6.004E-5	471	0.057	0.081	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
16	PDB:7jvrR	0.302	0.672	7.905E-5	269	0.060	0.149	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7vl9R	0.316	0.609	7.905E-5	302	0.068	0.149	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
18	PDB:7x9cR	0.279	0.551	1.041E-4	302	0.069	0.152	7x9cR.pdb.gz
19	PDB:7w2zR	0.303	0.579	1.141E-4	301	0.062	0.136	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
20	PDB:7wq3R	0.303	0.629	1.194E-4	289	0.048	0.111	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZWZ3	0.0	1218	602	0.874	0.967	A0A8I5ZWZ3_RAT Frizzled class receptor 3 OS=Rattus norvegicus OX=10116 GN=Fzd3 PE=3 SV=1
2	M0RCN5	0.0	1235	624	0.884	0.944	M0RCN5_RAT Frizzled class receptor 3 OS=Rattus norvegicus OX=10116 GN=Fzd3 PE=3 SV=2
3	O42579	0.0	1247	664	0.889	0.892	FZD3_XENLA Frizzled-3 OS=Xenopus laevis OX=8355 GN=fzd3 PE=1 SV=1
4	O60353	0.0	690	706	0.524	0.494	FZD6_HUMAN Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6 PE=1 SV=2
5	Q5TZ38	0.0	1075	685	0.763	0.742	Q5TZ38_DANRE Frizzled class receptor 3a OS=Danio rerio OX=7955 GN=fzd3 PE=2 SV=1
6	Q61086	0.0	1368	666	0.982	0.982	FZD3_MOUSE Frizzled-3 OS=Mus musculus OX=10090 GN=Fzd3 PE=1 SV=1
7	Q61089	0.0	669	709	0.502	0.471	FZD6_MOUSE Frizzled-6 OS=Mus musculus OX=10090 GN=Fzd6 PE=1 SV=1
8	Q8CJC4	0.0	1364	666	0.977	0.977	Q8CJC4_RAT Frizzled-3 protein OS=Rattus norvegicus OX=10116 GN=Fzd3 PE=2 SV=1
9	Q8WMU5	0.0	697	712	0.527	0.493	FZD6_CANLF Frizzled-6 OS=Canis lupus familiaris OX=9615 GN=FZD6 PE=2 SV=1
10	Q9NPG1	0.0	1388	666	1.000	1.000	FZD3_HUMAN Frizzled-3 OS=Homo sapiens OX=9606 GN=FZD3 PE=1 SV=1
11	Q6P0Y7	1.49e-166	492	617	0.417	0.451	Q6P0Y7_DANRE Frizzled-6 precursor OS=Danio rerio OX=7955 GN=zgc:65879 PE=2 SV=1
12	O70421	3.24e-162	482	642	0.360	0.374	FZD1_MOUSE Frizzled-1 OS=Mus musculus OX=10090 GN=Fzd1 PE=1 SV=3
13	Q9UP38	3.26e-162	482	647	0.359	0.369	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
14	O75084	7.34e-162	479	574	0.354	0.411	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
15	Q8AVJ9	8.21e-162	478	548	0.356	0.432	FZD7B_XENLA Frizzled-7-B OS=Xenopus laevis OX=8355 GN=fzd7-b PE=1 SV=1
16	Q9PUK8	1.11e-161	478	549	0.354	0.430	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
17	Q6NV44	1.14e-161	478	559	0.356	0.424	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
18	Q61090	1.85e-160	475	572	0.356	0.414	FZD7_MOUSE Frizzled-7 OS=Mus musculus OX=10090 GN=Fzd7 PE=1 SV=2
19	Q90YL7	2.09e-160	474	550	0.351	0.425	Q90YL7_DANRE Frizzled homolog 2 OS=Danio rerio OX=7955 GN=zfz2 PE=2 SV=1
20	Q08463	2.47e-160	477	641	0.360	0.374	FZD1_RAT Frizzled-1 OS=Rattus norvegicus OX=10116 GN=Fzd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01534 Frizzled	7.7e-121	414.8	Frizzled/Smoothened family membrane region
2	PF01392 Fz	6.8e-24	96.1	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.985	Protein Wnt-5a
2	9606.ENSP00000357040	0.978	Vang-like protein 2
3	9606.ENSP00000290167	0.961	Protein Wnt-4
4	9606.ENSP00000219255	0.946	Partitioning defective 6 homolog alpha
5	9606.ENSP00000005340	0.943	Segment polarity protein dishevelled homolog DVL-2
6	9606.ENSP00000368169	0.937	Segment polarity protein dishevelled homolog DVL-1
7	9606.ENSP00000380379	0.928	Protein Wnt-5b
8	9606.ENSP00000261349	0.918	Low-density lipoprotein receptor-related protein 6
9	9606.ENSP00000294304	0.914	Low-density lipoprotein receptor-related protein 5
10	9606.ENSP00000293549	0.911	Proto-oncogene Wnt-1
11	9606.ENSP00000434034	0.911	Frizzled-4
12	9606.ENSP00000354607	0.910	Frizzled-5
13	9606.ENSP00000323901	0.908	Frizzled-2
14	9606.ENSP00000287934	0.907	Frizzled-1
15	9606.ENSP00000286201	0.906	Frizzled-7
16	9606.ENSP00000351605	0.904	Frizzled-6
17	9606.ENSP00000316054	0.903	Segment polarity protein dishevelled homolog DVL-3
18	9606.ENSP00000164024	0.895	Cadherin EGF LAG seven-pass G-type receptor 3
19	9606.ENSP00000284523	0.892	Protein Wnt-3a
20	9606.ENSP00000347672	0.881	VANGL planar cell polarity protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042813	1.000	Wnt receptor activity
GO:0017147	0.970	Wnt-protein binding
GO:0005102	0.347	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0048856	0.997	anatomical structure development
GO:0032501	0.996	multicellular organismal process
GO:0198738	0.992	cell-cell signaling by wnt
GO:0007275	0.990	multicellular organism development
GO:0060322	0.989	head development
GO:1905114	0.985	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0007399	0.977	nervous system development
GO:0016055	0.974	Wnt signaling pathway
GO:0007420	0.906	brain development
GO:0009653	0.869	anatomical structure morphogenesis
GO:0030154	0.575	cell differentiation
GO:0071840	0.550	cellular component organization or biogenesis
GO:0016043	0.515	cellular component organization
GO:0060070	0.496	canonical Wnt signaling pathway
GO:0048518	0.410	positive regulation of biological process
GO:0048522	0.383	positive regulation of cellular process
GO:0009888	0.348	tissue development
GO:0042221	0.336	response to chemical
GO:0019222	0.336	regulation of metabolic process
GO:0060255	0.319	regulation of macromolecule metabolic process
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.989	cytoplasm
GO:0043226	0.735	organelle
GO:0043229	0.709	intracellular organelle
GO:0043231	0.688	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]