StarFunc result for job id Q9NPG4

User Input

>input (1184 residues)
MMQLLQLLLGLLGPGGYLFLLGDCQEVTTLTVKYQVSEEVPSGTVIGKLSQELGREERRR
QAGAAFQVLQLPQALPIQVDSEEGLLSTGRRLDREQLCRQWDPCLVSFDVLATGDLALIH
VEIQVLDINDHQPRFPKGEQELEISESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHF
ALDVIVGPDETKHAELIVVKELDREIHSFFDLVLTAYDNGNPPKSGTSLVKVNVLDSNDN
SPAFAESSLALEIQEDAAPGTLLIKLTATDPDQGPNGEVEFFLSKHMPPEVLDTFSIDAK
TGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDVNDNIPSIHVTWASQP
SLVSEALPKDSFIALVMADDLDSGHNGLVHCWLSQELGHFRLKRTNGNTYMLLTNATLDR
EQWPKYTLTLLAQDQGLQPLSAKKQLSIQISDINDNAPVFEKSRYEVSTRENNLPSLHLI
TIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDS
GQPMLASSVSVWVSLLDANDNAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETPNGLGP
AGTDTPPLATHSSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNV
TNASSLIGSEWELEIVVEDQGSPPLQTRALLRVMFVTSVDHLRDSARKPGALSMSMLTVI
CLAVLLGIFGLILALFMSICRTEKKDNRAYNCREAESTYRQQPKRPQKHIQKADIHLVPV
LRGQAGEPCEVGQSHKDVDKEAMMEAGWDPCLQAPFHLTPTLYRTLRNQGNQGAPAESRE
VLQDTVNLLFNHPRQRNASRENLNLPEPQPATGQPRSRPLKVAGSPTGRLAGDQGSEEAP
QRPPASSATLRRQRHLNGKVSPEKESGPRQILRSLVRLSVAAFAERNPVEELTVDSPPVQ
QISQLLSLLHQGQFQPKPNHRGNKYLAKPGGSRSAIPDTDGPSARAGGQTDPEQEEGPLD
PEEDLSVKQLLEEELSSLLDPSTGLALDRLSAPDPAWMARLSLPLTTNYRDNVISPDAAA
TEEPRTFQTFGKAEAPELSPTGTRLASTFVSEMSSLLEMLLEQRSSMPVEAASEALRRLS
VCGRTLSLDLATSAASGMKVQGDPGGKTGTEGKSRGSSSSSRCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55134	0.636	0.638	0.000	1180	0.802	0.804	O55134.pdb.gz	PCD12_MOUSE Protocadherin-12 OS=Mus musculus OX=10090 GN=Pcdh12 PE=1 SV=2
2	AFDB:Q9NPG4	1.000	1.000	0.000	1184	1.000	1.000	Q9NPG4.pdb.gz	PCD12_HUMAN Protocadherin-12 OS=Homo sapiens OX=9606 GN=PCDH12 PE=1 SV=1
3	AFDB:A0A2R8RMH2	0.525	0.539	1.212E-94	1150	0.320	0.330	A0A2R8RMH2.pdb.gz
4	AFDB:F1QRP2	0.463	0.480	7.203E-94	1135	0.318	0.331	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
5	AFDB:Q9HCL0	0.515	0.535	1.501E-93	1135	0.313	0.327	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
6	AFDB:O14917	0.425	0.433	4.583E-89	1159	0.299	0.305	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
7	AFDB:C4P342	0.477	0.494	4.601E-88	1137	0.295	0.307	C4P342.pdb.gz	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
8	AFDB:A0A2R8QME5	0.492	0.529	7.462E-85	1094	0.277	0.300	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
9	AFDB:Q91XX9	0.421	0.518	2.261E-82	932	0.248	0.315	Q91XX9.pdb.gz	Q91XX9_MOUSE Protocadherin gamma A9 OS=Mus musculus OX=10090 GN=Pcdhga9 PE=1 SV=1
10	AFDB:Q9UN74	0.483	0.592	1.416E-81	947	0.241	0.301	Q9UN74.pdb.gz	PCDA4_HUMAN Protocadherin alpha-4 OS=Homo sapiens OX=9606 GN=PCDHA4 PE=1 SV=1
11	PDB:4aq1A	0.100	0.143	6.552E-14	721	0.067	0.110	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:6velC	0.144	0.727	1.107E-13	209	0.042	0.239	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:5oj2B	0.113	0.170	1.697E-11	692	0.070	0.120	5oj2B.pdb.gz
14	PDB:1e07A	0.140	0.199	2.205E-11	642	0.050	0.092	1e07A.pdb.gz
15	PDB:4rtdA	0.077	0.081	6.708E-8	1122	0.056	0.059	4rtdA.pdb.gz
16	PDB:6dldD	0.105	0.291	3.590E-7	269	0.028	0.123	6dldD.pdb.gz
17	PDB:7q5zA	0.089	0.081	2.497E-6	1344	0.059	0.052	7q5zA.pdb.gz
18	PDB:7vonA	0.085	0.075	3.798E-6	1399	0.055	0.046	7vonA.pdb.gz
19	PDB:4g1eA	0.083	0.097	4.218E-6	964	0.056	0.068	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
20	PDB:6dlfA	0.119	0.371	4.218E-6	236	0.032	0.161	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9CPE6	0.0	587	1150	0.274	0.282	A9CPE6_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh 18 PE=2 SV=2
2	A9QUV5	0.0	602	1123	0.272	0.287	A9QUV5_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh18 PE=2 SV=1
3	F1QRP2	0.0	603	1135	0.272	0.284	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
4	O55134	0.0	1848	1180	0.790	0.792	PCD12_MOUSE Protocadherin-12 OS=Mus musculus OX=10090 GN=Pcdh12 PE=1 SV=2
5	Q8VHR0	0.0	618	1134	0.275	0.287	PCD18_MOUSE Protocadherin 18 OS=Mus musculus OX=10090 GN=Pcdh18 PE=1 SV=2
6	Q9HCL0	0.0	610	1135	0.273	0.285	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
7	Q9NPG4	0.0	2415	1184	1.000	1.000	PCD12_HUMAN Protocadherin-12 OS=Homo sapiens OX=9606 GN=PCDH12 PE=1 SV=1
8	A0A2R8QI99	2.92e-158	500	997	0.244	0.290	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
9	Q6NYV7	4.12e-158	499	1001	0.244	0.289	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
10	Q805F0	1.38e-153	488	1026	0.247	0.286	Q805F0_DANRE Protocadherin 10 OS=Danio rerio OX=7955 GN=pcdh10 PE=2 SV=1
11	Q3UTP0	1.21e-151	474	755	0.259	0.407	Q3UTP0_MOUSE Cadherin domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
12	C4P342	1.77e-150	483	1137	0.261	0.272	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
13	E9PXF0	6.14e-149	479	1157	0.266	0.272	E9PXF0_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=1 SV=1
14	Q5HZI5	1.32e-148	479	1157	0.266	0.272	Q5HZI5_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
15	Q6P0A6	1.42e-147	468	896	0.251	0.331	Q6P0A6_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
16	Q9Z1B1	1.06e-146	466	896	0.251	0.331	Q9Z1B1_MOUSE OL-protocadherin OS=Mus musculus OX=10090 GN=Pcdh10 PE=2 SV=1
17	B5TR11	1.55e-146	468	979	0.241	0.291	B5TR11_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 GN=PAPC PE=1 SV=1
18	O14917	2.56e-146	473	1159	0.264	0.270	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
19	Q925I8	3.51e-146	469	1040	0.250	0.285	Q925I8_MOUSE OL-protocadherin isoform OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
20	E9PXQ7	9.95e-146	468	1057	0.250	0.280	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	2.4e-76	263.6	Cadherin domain
2	PF08266 Cadherin_2	2.3e-15	67.5	Cadherin-like
3	PF16184 Cadherin_3	2.5	19.5	Cadherin-like
4	PF03413 PepSY	1.4e+02	14.4	Peptidase propeptide and YPEB domain
5	PF18957 RibLong	43	16.3	Long Rib domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000469205	0.634	SLIT and NTRK-like protein 4
2	9606.ENSP00000326759	0.600	Leucine-rich repeats and immunoglobulin-like domains protein 3
3	9606.ENSP00000362330	0.592	Chromodomain-helicase-DNA-binding protein 6
4	9606.ENSP00000367151	0.566	Protocadherin-17
5	9606.ENSP00000381535	0.508	Serine/threonine kinase 32A
6	9606.ENSP00000358165	0.501	High affinity immunoglobulin gamma Fc receptor I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.973	ion binding
GO:0046872	0.960	metal ion binding
GO:0005509	0.913	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0032502	0.980	developmental process
GO:0048856	0.943	anatomical structure development
GO:0048731	0.895	system development
GO:0007399	0.654	nervous system development
GO:0050789	0.468	regulation of biological process
GO:0050794	0.416	regulation of cellular process
GO:0008037	0.360	cell recognition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.983	plasma membrane
GO:0043226	0.975	organelle
GO:0043227	0.944	membrane-bounded organelle
GO:0030054	0.914	cell junction
GO:0005576	0.910	extracellular region
GO:0005615	0.844	extracellular space
GO:0031982	0.817	vesicle
GO:0005622	0.790	intracellular anatomical structure
GO:0043229	0.690	intracellular organelle
GO:0005737	0.528	cytoplasm
GO:0070062	0.315	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]