StarFunc result for job id Q9NPH3

User Input

>input (570 residues)
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61730	0.650	0.650	0.000	570	0.891	0.891	Q61730.pdb.gz	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
2	AFDB:Q9NPH3	1.000	1.000	0.000	570	1.000	1.000	Q9NPH3.pdb.gz	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
3	AFDB:Q70YG5	0.700	0.702	9.584E-68	568	0.421	0.423	Q70YG5.pdb.gz	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
4	AFDB:B6ZK77	0.561	0.468	1.117E-54	700	0.340	0.277	B6ZK77.pdb.gz	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
5	AFDB:P59824	0.563	0.470	7.430E-54	696	0.335	0.274	P59824.pdb.gz	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
6	AFDB:Q9NP60	0.587	0.502	1.660E-53	686	0.358	0.297	Q9NP60.pdb.gz	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
7	AFDB:B6ZK78	0.575	0.493	8.141E-50	681	0.319	0.267	B6ZK78.pdb.gz	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
8	AFDB:P14719	0.589	0.592	3.173E-46	567	0.254	0.256	P14719.pdb.gz	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
9	AFDB:P13504	0.555	0.551	2.507E-45	576	0.242	0.240	P13504.pdb.gz	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
10	AFDB:Q90874	0.631	0.645	2.507E-45	555	0.247	0.254	Q90874.pdb.gz	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
11	PDB:6dldD	0.164	0.280	5.579E-11	269	0.091	0.193	6dldD.pdb.gz
12	PDB:1e07A	0.154	0.142	7.434E-11	642	0.088	0.078	1e07A.pdb.gz
13	PDB:3o3uN	0.236	0.233	2.949E-10	580	0.054	0.053	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
14	PDB:2rcjC	0.184	0.197	1.043E-9	523	0.082	0.090	2rcjC.pdb.gz
15	PDB:1hzhH	0.147	0.177	1.651E-9	457	0.077	0.096	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
16	PDB:6dlfA	0.131	0.276	2.614E-9	236	0.077	0.186	6dlfA.pdb.gz
17	PDB:1igtB	0.128	0.157	1.641E-8	444	0.096	0.124	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
18	PDB:4r2gP	0.206	0.449	2.752E-8	210	0.060	0.162	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
19	PDB:5oj2B	0.191	0.165	4.887E-8	692	0.095	0.078	5oj2B.pdb.gz
20	PDB:6enyC	0.211	0.297	5.175E-8	364	0.063	0.099	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61730	0.0	1043	570	0.891	0.891	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
2	Q63621	0.0	1034	570	0.889	0.889	IL1AP_RAT Interleukin-1 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il1rap PE=2 SV=1
3	Q9NPH3	0.0	1185	570	1.000	1.000	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
4	Q70YG5	8.05e-157	462	568	0.419	0.421	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
5	B6ZK77	1.83e-101	323	700	0.361	0.294	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
6	Q9NP60	6.01e-98	314	686	0.372	0.309	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
7	Q9NZN1	2.38e-87	286	696	0.340	0.279	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
8	B6ZK78	1.91e-86	284	681	0.318	0.266	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
9	P59824	2.65e-85	281	696	0.337	0.276	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
10	P59823	5.40e-84	278	695	0.340	0.279	IRPL1_MOUSE Interleukin-1 receptor accessory protein-like 1 OS=Mus musculus OX=10090 GN=Il1rapl1 PE=1 SV=1
11	Q13478	2.53e-52	189	541	0.293	0.309	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
12	O95256	1.89e-47	177	599	0.251	0.239	I18RA_HUMAN Interleukin-18 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL18RAP PE=1 SV=1
13	Q9Z2B1	6.52e-46	172	614	0.228	0.212	I18RA_MOUSE Interleukin-18 receptor accessory protein OS=Mus musculus OX=10090 GN=Il18rap PE=2 SV=1
14	A0A0G2K2K7	7.03e-46	173	627	0.246	0.223	A0A0G2K2K7_RAT Interleukin 18 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il18rap PE=3 SV=1
15	Q01638	7.47e-46	171	556	0.256	0.263	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
16	Q9ERS7	1.16e-45	171	574	0.272	0.270	ILRL2_MOUSE Interleukin-1 receptor-like 2 OS=Mus musculus OX=10090 GN=Il1rl2 PE=1 SV=1
17	Q02955	6.73e-45	169	576	0.244	0.241	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
18	Q61098	3.93e-43	164	537	0.272	0.289	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
19	P13504	8.36e-43	163	576	0.254	0.252	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
20	P14719	1.27e-42	162	567	0.254	0.256	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.00019	32.7	Immunoglobulin I-set domain
2	PF00047 ig	3.8e-05	35.1	Immunoglobulin domain
3	PF13895 Ig_2	8.1e-09	47.0	Immunoglobulin domain
4	PF13927 Ig_3	1.7e-11	55.9	Immunoglobulin domain
5	PF18452 Ig_6	3.3e-06	38.4	Immunoglobulin domain
6	PF01582 TIR	1.3e-36	137.6	TIR domain
7	PF13676 TIR_2	9.9e-06	37.6	TIR domain
8	PF07686 V-set	17	17.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000027076

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000021191	0.994	Multifunctional fusion protein
2	9598.ENSPTRP00000021068	0.985	Uncharacterized protein
3	9598.ENSPTRP00000021065	0.962	Uncharacterized protein
4	9598.ENSPTRP00000035514	0.935	Interleukin 33
5	9598.ENSPTRP00000025449	0.923	Myeloid differentiation primary response protein MyD88
6	9598.ENSPTRP00000038647	0.913	Interleukin-1 receptor-associated kinase 1
7	9598.ENSPTRP00000021196	0.909	Interleukin-1
8	9598.ENSPTRP00000021189	0.893	Interleukin-1
9	9598.ENSPTRP00000021198	0.860	Interleukin-1
10	9598.ENSPTRP00000021069	0.854	Uncharacterized protein
11	9598.ENSPTRP00000008285	0.846	Interleukin-1 receptor-associated kinase 4
12	9598.ENSPTRP00000006096	0.828	Belongs to the TNF receptor-associated factor family.
13	9598.ENSPTRP00000021201	0.796	Interleukin-1
14	9598.ENSPTRP00000025212	0.791	Uncharacterized protein
15	9598.ENSPTRP00000017562	0.728	Uncharacterized protein
16	9598.ENSPTRP00000008814	0.721	Interleukin-1 receptor-associated kinase 3
17	9598.ENSPTRP00000021194	0.717	Interleukin-1
18	9598.ENSPTRP00000021193	0.701	Interleukin-1
19	9598.ENSPTRP00000027637	0.695	Uncharacterized protein
20	9598.ENSPTRP00000060406	0.670	Pan troglodytes toll-like receptor adaptor molecule 2 (TICAM2), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	0.999	cytokine receptor activity
GO:0005102	0.868	signaling receptor binding
GO:0005126	0.670	cytokine receptor binding
GO:0070851	0.632	growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.987	response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0002376	0.953	immune system process
GO:0007154	0.931	cell communication
GO:0023052	0.928	signaling
GO:0048518	0.926	positive regulation of biological process
GO:0006954	0.916	inflammatory response
GO:0048522	0.884	positive regulation of cellular process
GO:0016043	0.859	cellular component organization
GO:0006955	0.847	immune response
GO:0051716	0.780	cellular response to stimulus
GO:0007165	0.765	signal transduction
GO:0050803	0.755	regulation of synapse structure or activity
GO:0048583	0.745	regulation of response to stimulus
GO:0007166	0.719	cell surface receptor signaling pathway
GO:0019222	0.708	regulation of metabolic process
GO:0051239	0.700	regulation of multicellular organismal process
GO:0060255	0.685	regulation of macromolecule metabolic process
GO:0048584	0.675	positive regulation of response to stimulus
GO:0001817	0.674	regulation of cytokine production
GO:0065009	0.657	regulation of molecular function
GO:0044087	0.640	regulation of cellular component biogenesis
GO:0051240	0.638	positive regulation of multicellular organismal process
GO:0010628	0.621	positive regulation of gene expression
GO:0019221	0.620	cytokine-mediated signaling pathway
GO:0002684	0.516	positive regulation of immune system process
GO:0051091	0.503	positive regulation of DNA-binding transcription factor activity
GO:0032501	0.417	multicellular organismal process
GO:0001819	0.414	positive regulation of cytokine production
GO:0051128	0.396	regulation of cellular component organization
GO:0032101	0.389	regulation of response to external stimulus
GO:1901888	0.363	regulation of cell junction assembly
GO:0032502	0.362	developmental process
GO:0050807	0.358	regulation of synapse organization
GO:0022607	0.326	cellular component assembly
GO:1905606	0.318	regulation of presynapse assembly
GO:0050793	0.315	regulation of developmental process
GO:0032675	0.301	regulation of interleukin-6 production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005737	0.993	cytoplasm
GO:0005886	0.979	plasma membrane
GO:0032991	0.949	protein-containing complex
GO:0005576	0.886	extracellular region
GO:0043226	0.873	organelle
GO:0005829	0.745	cytosol
GO:0043227	0.720	membrane-bounded organelle
GO:0043229	0.579	intracellular organelle
GO:0043231	0.427	intracellular membrane-bounded organelle
GO:0098978	0.414	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]