StarFunc result for job id Q9NPH5

User Input

>input (578 residues)
MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPH5	1.000	1.000	0.000	578	1.000	1.000	Q9NPH5.pdb.gz	NOX4_HUMAN NADPH oxidase 4 OS=Homo sapiens OX=9606 GN=NOX4 PE=1 SV=2
2	AFDB:Q924V1	0.963	0.963	7.717E-99	578	0.900	0.900	Q924V1.pdb.gz	NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus OX=10116 GN=Nox4 PE=1 SV=2
3	AFDB:Q61093	0.841	0.852	1.221E-51	570	0.379	0.384	Q61093.pdb.gz	CY24B_MOUSE Cytochrome b-245 heavy chain OS=Mus musculus OX=10090 GN=Cybb PE=1 SV=1
4	AFDB:Q9HBY0	0.840	0.854	2.498E-50	568	0.344	0.350	Q9HBY0.pdb.gz	NOX3_HUMAN NADPH oxidase 3 OS=Homo sapiens OX=9606 GN=NOX3 PE=1 SV=1
5	AFDB:O46522	0.840	0.851	2.634E-50	570	0.379	0.384	O46522.pdb.gz	CY24B_BOVIN Cytochrome b-245 heavy chain OS=Bos taurus OX=9913 GN=CYBB PE=2 SV=1
6	AFDB:Q8CIZ9	0.820	0.803	2.928E-50	591	0.356	0.349	Q8CIZ9.pdb.gz	NOX1_MOUSE NADPH oxidase 1 OS=Mus musculus OX=10090 GN=Nox1 PE=1 SV=2
7	AFDB:Q9Y5S8	0.825	0.845	3.256E-50	564	0.353	0.362	Q9Y5S8.pdb.gz	NOX1_HUMAN NADPH oxidase 1 OS=Homo sapiens OX=9606 GN=NOX1 PE=1 SV=2
8	AFDB:Q672J9	0.828	0.842	8.906E-50	568	0.353	0.359	Q672J9.pdb.gz	NOX3_MOUSE NADPH oxidase 3 OS=Mus musculus OX=10090 GN=Nox3 PE=1 SV=2
9	AFDB:B8YQA0	0.833	0.851	1.224E-49	565	0.349	0.358	B8YQA0.pdb.gz	B8YQA0_SALSA Cytochrome b-245, beta polypeptide OS=Salmo salar OX=8030 GN=gp91phox PE=2 SV=1
10	AFDB:Q9XYS3	0.754	0.838	6.057E-41	517	0.311	0.348	Q9XYS3.pdb.gz	NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum OX=44689 GN=noxA PE=2 SV=1
11	PDB:7u8gA	0.370	0.794	1.054E-15	260	0.166	0.369	7u8gA.pdb.gz	Structure of the core human NADPH oxidase NOX2.
12	PDB:1gvhA	0.371	0.514	1.579E-10	396	0.093	0.136	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
13	PDB:7romA	0.326	0.677	2.827E-10	255	0.073	0.165	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD
14	PDB:1fdrA	0.325	0.708	3.314E-10	244	0.066	0.156	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
15	PDB:1qfjA	0.311	0.726	5.934E-10	226	0.076	0.195	1qfjA.pdb.gz
16	PDB:3crzA	0.331	0.684	6.956E-10	257	0.061	0.136	3crzA.pdb.gz	X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
17	PDB:1ep1B	0.242	0.490	8.154E-10	261	0.073	0.161	1ep1B.pdb.gz	Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
18	PDB:1cqxA	0.298	0.403	2.230E-9	403	0.085	0.122	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
19	PDB:5gv7A	0.301	0.590	3.694E-8	272	0.067	0.143	5gv7A.pdb.gz	Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
20	PDB:3lvbA	0.297	0.512	1.123E-7	311	0.074	0.138	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q924V1	0.0	1098	578	0.900	0.900	NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus OX=10116 GN=Nox4 PE=1 SV=2
2	Q9JHI8	0.0	1108	578	0.907	0.907	NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus OX=10090 GN=Nox4 PE=1 SV=1
3	Q9NPH5	0.0	1203	578	1.000	1.000	NOX4_HUMAN NADPH oxidase 4 OS=Homo sapiens OX=9606 GN=NOX4 PE=1 SV=2
4	Q61093	8.43e-122	373	570	0.391	0.396	CY24B_MOUSE Cytochrome b-245 heavy chain OS=Mus musculus OX=10090 GN=Cybb PE=1 SV=1
5	Q9ERL1	3.52e-120	369	570	0.388	0.393	Q9ERL1_RAT Cytochrome b-245, beta polypeptide OS=Rattus norvegicus OX=10116 GN=Cybb PE=4 SV=2
6	P04839	1.97e-119	367	570	0.396	0.402	CY24B_HUMAN Cytochrome b-245 heavy chain OS=Homo sapiens OX=9606 GN=CYBB PE=1 SV=2
7	Q9ER28	2.30e-117	361	570	0.382	0.388	Q9ER28_RAT Endothelial type gp91-phox OS=Rattus norvegicus OX=10116 GN=Cybb PE=2 SV=1
8	O46522	1.04e-116	359	570	0.393	0.398	CY24B_BOVIN Cytochrome b-245 heavy chain OS=Bos taurus OX=9913 GN=CYBB PE=2 SV=1
9	Q9HBY0	5.47e-115	355	568	0.358	0.364	NOX3_HUMAN NADPH oxidase 3 OS=Homo sapiens OX=9606 GN=NOX3 PE=1 SV=1
10	Q672K1	1.06e-114	354	568	0.367	0.373	NOX3_RAT NADPH oxidase 3 OS=Rattus norvegicus OX=10116 GN=Nox3 PE=2 SV=1
11	B8YQA0	4.02e-114	353	565	0.355	0.363	B8YQA0_SALSA Cytochrome b-245, beta polypeptide OS=Salmo salar OX=8030 GN=gp91phox PE=2 SV=1
12	Q672J9	1.78e-112	348	568	0.363	0.370	NOX3_MOUSE NADPH oxidase 3 OS=Mus musculus OX=10090 GN=Nox3 PE=1 SV=2
13	Q9Y5S8	2.69e-109	340	564	0.365	0.374	NOX1_HUMAN NADPH oxidase 1 OS=Homo sapiens OX=9606 GN=NOX1 PE=1 SV=2
14	Q8CIZ9	1.19e-104	329	591	0.369	0.360	NOX1_MOUSE NADPH oxidase 1 OS=Mus musculus OX=10090 GN=Nox1 PE=1 SV=2
15	Q9WV87	8.60e-104	326	563	0.360	0.369	NOX1_RAT NADPH oxidase 1 OS=Rattus norvegicus OX=10116 GN=Nox1 PE=2 SV=1
16	Q2PEN8	5.14e-78	259	575	0.324	0.325	Q2PEN8_9HYPO NADPH oxidase OS=Epichloe festucae OX=35717 GN=noxB PE=4 SV=1
17	G5EB25	8.08e-71	239	550	0.299	0.315	G5EB25_EMENI FAD-binding FR-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05457 PE=4 SV=1
18	Q2PEP0	1.49e-63	220	557	0.280	0.291	Q2PEP0_9HYPO NADPH oxidase OS=Epichloe festucae OX=35717 GN=noxA PE=4 SV=1
19	Q9XYS3	3.76e-57	202	517	0.211	0.236	NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum OX=44689 GN=noxA PE=2 SV=1
20	Q86GL4	2.94e-53	195	698	0.202	0.168	NOXB_DICDI Superoxide-generating NADPH oxidase heavy chain subunit B OS=Dictyostelium discoideum OX=44689 GN=noxB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03472 Autoind_bind	3.5e+02	12.0	Autoinducer binding domain
2	PF08022 FAD_binding_8	7.5e-11	53.5	FAD-binding domain
3	PF01794 Ferric_reduct	2.5e-21	87.5	Ferric reductase like transmembrane component
4	PF00175 NAD_binding_1	94	15.1	Oxidoreductase NAD-binding domain
5	PF08030 NAD_binding_6	2.3e-20	84.8	Ferric reductase NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261623	0.998	Cytochrome b-245 light chain
2	9606.ENSP00000363089	0.994	Toll-like receptor 4
3	9606.ENSP00000475924	0.986	DNA polymerase delta interacting protein 2
4	9606.ENSP00000289473	0.966	Neutrophil cytosol factor 1
5	9606.ENSP00000360683	0.951	Tyrosine-protein phosphatase non-receptor type 1
6	9606.ENSP00000356505	0.943	Neutrophil cytosol factor 2
7	9606.ENSP00000341208	0.912	Signal transducer and activator of transcription 5A
8	9606.ENSP00000293328	0.911	Signal transducer and activator of transcription 5B
9	9606.ENSP00000342848	0.902	NADPH oxidase activator 1
10	9606.ENSP00000380450	0.895	NADPH oxidase organizer 1
11	9606.ENSP00000367851	0.887	Cytochrome b-245 heavy chain
12	9606.ENSP00000380334	0.885	Neutrophil cytosol factor 4
13	9606.ENSP00000362057	0.871	NADPH oxidase 1
14	9606.ENSP00000364210	0.850	Advanced glycosylation end product-specific receptor
15	9606.ENSP00000263923	0.839	Vascular endothelial growth factor receptor 2
16	9606.ENSP00000306275	0.831	Potassium channel subfamily K member 3
17	9606.ENSP00000327801	0.802	Protein disulfide-isomerase
18	9606.ENSP00000241052	0.793	Catalase
19	9606.ENSP00000323148	0.787	Zinc finger protein with KRAB and SCAN domains 1
20	9606.ENSP00000200453	0.785	Protein phosphatase 1 regulatory subunit 15A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050664	1.000	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0097159	0.741	organic cyclic compound binding
GO:1901363	0.708	heterocyclic compound binding
GO:0043167	0.628	ion binding
GO:0016174	0.588	NAD(P)H oxidase H2O2-forming activity
GO:0036094	0.362	small molecule binding
GO:0043168	0.340	anion binding
GO:0019899	0.334	enzyme binding
GO:0050660	0.305	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.996	metabolic process
GO:0050896	0.992	response to stimulus
GO:0072593	0.978	reactive oxygen species metabolic process
GO:0006801	0.972	superoxide metabolic process
GO:0050789	0.960	regulation of biological process
GO:0050794	0.948	regulation of cellular process
GO:0048518	0.919	positive regulation of biological process
GO:0006950	0.916	response to stress
GO:0051716	0.916	cellular response to stimulus
GO:0048522	0.839	positive regulation of cellular process
GO:0019222	0.778	regulation of metabolic process
GO:0071704	0.745	organic substance metabolic process
GO:0042221	0.744	response to chemical
GO:0032501	0.639	multicellular organismal process
GO:0009893	0.578	positive regulation of metabolic process
GO:0070887	0.574	cellular response to chemical stimulus
GO:0044238	0.550	primary metabolic process
GO:0031323	0.521	regulation of cellular metabolic process
GO:0032502	0.502	developmental process
GO:0060255	0.502	regulation of macromolecule metabolic process
GO:0006807	0.497	nitrogen compound metabolic process
GO:0048583	0.437	regulation of response to stimulus
GO:0080090	0.429	regulation of primary metabolic process
GO:0051171	0.427	regulation of nitrogen compound metabolic process
GO:1901700	0.418	response to oxygen-containing compound
GO:1901564	0.414	organonitrogen compound metabolic process
GO:0043170	0.403	macromolecule metabolic process
GO:0010033	0.396	response to organic substance
GO:0031325	0.360	positive regulation of cellular metabolic process
GO:0048856	0.346	anatomical structure development
GO:0003013	0.339	circulatory system process
GO:0048519	0.330	negative regulation of biological process
GO:0009889	0.325	regulation of biosynthetic process
GO:0010604	0.323	positive regulation of macromolecule metabolic process
GO:0048584	0.319	positive regulation of response to stimulus
GO:0009966	0.318	regulation of signal transduction
GO:0051173	0.313	positive regulation of nitrogen compound metabolic process
GO:0065009	0.312	regulation of molecular function
GO:0031326	0.306	regulation of cellular biosynthetic process
GO:0071310	0.304	cellular response to organic substance
GO:0023052	0.300	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005886	0.996	plasma membrane
GO:0012505	0.995	endomembrane system
GO:0005783	0.940	endoplasmic reticulum
GO:0005829	0.899	cytosol
GO:0031090	0.876	organelle membrane
GO:0005739	0.809	mitochondrion
GO:0032991	0.556	protein-containing complex
GO:0043233	0.474	organelle lumen
GO:0070013	0.453	intracellular organelle lumen
GO:0031984	0.339	organelle subcompartment
GO:0048471	0.335	perinuclear region of cytoplasm
GO:0098827	0.309	endoplasmic reticulum subcompartment
GO:0042175	0.308	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.304	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.3.-	1.000	With oxygen as acceptor.
EC:1.6.3.1	0.588	NAD(P)H oxidase (H2O2-forming).

[back to server]