StarFunc result for job id Q9NPH9

User Input

>input (171 residues)
MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSH
CISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPH9	1.000	1.000	1.037E-24	171	1.000	1.000	Q9NPH9.pdb.gz	IL26_HUMAN Interleukin-26 OS=Homo sapiens OX=9606 GN=IL26 PE=1 SV=1
2	AFDB:P18893	0.672	0.649	1.632E-5	178	0.205	0.197	P18893.pdb.gz	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
3	AFDB:P43480	0.634	0.612	5.230E-5	178	0.187	0.180	P43480.pdb.gz	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
4	AFDB:P29456	0.731	0.704	9.129E-5	178	0.199	0.191	P29456.pdb.gz	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
5	AFDB:Q6A2H4	0.698	0.683	1.855E-4	175	0.205	0.200	Q6A2H4.pdb.gz	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
6	AFDB:Q5EFQ8	0.667	0.637	4.614E-4	180	0.181	0.172	Q5EFQ8.pdb.gz	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
7	AFDB:P22301	0.459	0.444	6.252E-4	178	0.216	0.208	P22301.pdb.gz	IL10_HUMAN Interleukin-10 OS=Homo sapiens OX=9606 GN=IL10 PE=1 SV=1
8	AFDB:Q9JKV9	0.597	0.582	8.053E-4	176	0.175	0.170	Q9JKV9.pdb.gz	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
9	PDB:6weoQ	0.506	0.591	8.787E-4	142	0.187	0.225	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
10	PDB:1ykbD	0.548	0.643	1.023E-3	142	0.175	0.211	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
11	AFDB:Q9GZX6	0.531	0.512	1.479E-3	179	0.175	0.168	Q9GZX6.pdb.gz	IL22_HUMAN Interleukin-22 OS=Homo sapiens OX=9606 GN=IL22 PE=1 SV=1
12	PDB:6df3C	0.476	0.515	2.545E-3	155	0.205	0.226	6df3C.pdb.gz
13	AFDB:Q13007	0.533	0.457	2.581E-3	206	0.175	0.146	Q13007.pdb.gz	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
14	PDB:4dohA	0.564	0.619	3.627E-3	153	0.175	0.196	4dohA.pdb.gz
15	PDB:2ilkA	0.392	0.424	4.915E-3	155	0.181	0.200	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
16	PDB:4x51A	0.394	0.461	1.286E-2	142	0.152	0.183	4x51A.pdb.gz
17	PDB:6gg1A	0.485	0.556	1.423E-2	145	0.170	0.200	6gg1A.pdb.gz
18	PDB:1lqsL	0.392	0.457	7.194E-2	142	0.164	0.197	1lqsL.pdb.gz
19	PDB:1ax8A	0.427	0.531	7.960E-2	130	0.099	0.131	1ax8A.pdb.gz
20	PDB:3pivB	0.498	0.531	8.808E-2	157	0.082	0.089	3pivB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPH9	5.29e-124	347	171	1.000	1.000	IL26_HUMAN Interleukin-26 OS=Homo sapiens OX=9606 GN=IL26 PE=1 SV=1
2	Q6FGS9	7.50e-05	43.5	178	0.257	0.247	Q6FGS9_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
3	P43480	9.30e-05	43.1	178	0.152	0.146	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
4	Q29408	1.21e-04	42.7	177	0.152	0.147	IL10_SHEEP Interleukin-10 OS=Ovis aries OX=9940 GN=IL10 PE=2 SV=1
5	Q6H8Q2	1.25e-04	42.7	177	0.152	0.147	Q6H8Q2_SHEEP Interleukin family protein OS=Ovis aries OX=9940 GN=il10 PE=3 SV=1
6	P22301	1.94e-04	42.4	178	0.257	0.247	IL10_HUMAN Interleukin-10 OS=Homo sapiens OX=9606 GN=IL10 PE=1 SV=1
7	Q6FGW4	1.94e-04	42.4	178	0.257	0.247	Q6FGW4_HUMAN Interleukin family protein OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
8	P03180	2.54e-04	42.0	170	0.193	0.194	IL10H_EBVB9 Viral interleukin-10 homolog OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BCRF1 PE=1 SV=1
9	P18893	6.83e-04	40.8	178	0.164	0.157	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
10	Q6A2H4	8.02e-04	40.4	175	0.158	0.154	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
11	Q71UZ1	0.001	40.0	160	0.193	0.206	Q71UZ1_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
12	P29456	0.002	38.9	178	0.140	0.135	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
13	Q13007	0.009	37.7	206	0.257	0.214	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
14	Q9JJY9	0.014	37.0	179	0.170	0.162	IL22_MOUSE Interleukin-22 OS=Mus musculus OX=10090 GN=Il22 PE=1 SV=1
15	Q5EFQ8	0.041	35.4	180	0.152	0.144	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
16	Q9JKV9	0.048	35.4	176	0.175	0.170	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
17	Q198B4	0.050	35.4	172	0.187	0.186	Q198B4_RAT Interleukin-22 (Fragment) OS=Rattus norvegicus OX=10116 GN=Il22 PE=2 SV=1
18	G3V6X6	0.054	35.0	179	0.187	0.179	G3V6X6_RAT Interleukin 22 OS=Rattus norvegicus OX=10116 GN=Il22 PE=3 SV=1
19	Q925S4	0.060	35.0	181	0.199	0.188	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
20	C5VUR1	0.54	32.3	173	0.251	0.249	C5VUR1_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il-22 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00726 IL10	5.2e-07	40.8	Interleukin 10
2	PF14565 IL22	0.025	26.3	Interleukin 22 IL-10-related T-cell-derived-inducible factor
3	PF16958 PRP9_N	1.8e+02	13.6	Pre-mRNA-splicing factor PRP9 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314976	0.985	Interleukin-20 receptor subunit alpha
2	9606.ENSP00000290200	0.956	Interleukin-10 receptor subunit beta
3	9606.ENSP00000343000	0.805	Interleukin-19
4	9606.ENSP00000264657	0.798	Signal transducer and activator of transcription 3
5	9606.ENSP00000442424	0.780	Interleukin-22
6	9606.ENSP00000431885	0.777	Non-receptor tyrosine-protein kinase TYK2
7	9606.ENSP00000354394	0.776	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000375795	0.759	Interleukin-24
9	9606.ENSP00000343204	0.751	Tyrosine-protein kinase JAK1
10	9606.ENSP00000337432	0.747	Interleukin-17F
11	9606.ENSP00000329991	0.732	Interferon lambda-1
12	9606.ENSP00000344192	0.719	Interleukin-17A
13	9606.ENSP00000328133	0.685	Interleukin-20 receptor subunit beta
14	9606.ENSP00000270800	0.684	Interleukin-22 receptor subunit alpha-1
15	9606.ENSP00000333639	0.681	Interferon lambda-2
16	9606.ENSP00000409000	0.609	Interferon lambda-3
17	9606.ENSP00000343952	0.595	Chemokine (C-C motif) receptor 6
18	9606.ENSP00000383715	0.595	C-C chemokine receptor type 6
19	9606.ENSP00000351671	0.594	C-C motif chemokine 20
20	9606.ENSP00000321345	0.565	Interleukin-23 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0023052	0.993	signaling
GO:0007154	0.993	cell communication
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0009967	0.985	positive regulation of signal transduction
GO:0009893	0.980	positive regulation of metabolic process
GO:0051252	0.979	regulation of RNA metabolic process
GO:0010604	0.971	positive regulation of macromolecule metabolic process
GO:1904892	0.968	regulation of receptor signaling pathway via STAT
GO:0010468	0.967	regulation of gene expression
GO:0009889	0.965	regulation of biosynthetic process
GO:0001817	0.962	regulation of cytokine production
GO:0048519	0.959	negative regulation of biological process
GO:0051240	0.948	positive regulation of multicellular organismal process
GO:0010628	0.948	positive regulation of gene expression
GO:0010556	0.936	regulation of macromolecule biosynthetic process
GO:0001819	0.936	positive regulation of cytokine production
GO:0031325	0.935	positive regulation of cellular metabolic process
GO:2001141	0.919	regulation of RNA biosynthetic process
GO:0042127	0.918	regulation of cell population proliferation
GO:0050896	0.904	response to stimulus
GO:0051173	0.891	positive regulation of nitrogen compound metabolic process
GO:0048523	0.890	negative regulation of cellular process
GO:0080134	0.888	regulation of response to stress
GO:0045935	0.882	positive regulation of nucleobase-containing compound metabolic process
GO:1902531	0.880	regulation of intracellular signal transduction
GO:0051254	0.865	positive regulation of RNA metabolic process
GO:1903506	0.856	regulation of nucleic acid-templated transcription
GO:0006355	0.846	regulation of DNA-templated transcription
GO:0031328	0.844	positive regulation of cellular biosynthetic process
GO:1904894	0.820	positive regulation of receptor signaling pathway via STAT
GO:0043408	0.807	regulation of MAPK cascade
GO:1902680	0.777	positive regulation of RNA biosynthetic process
GO:0045893	0.740	positive regulation of DNA-templated transcription
GO:0051716	0.723	cellular response to stimulus
GO:0006357	0.692	regulation of transcription by RNA polymerase II
GO:0007165	0.677	signal transduction
GO:1902533	0.675	positive regulation of intracellular signal transduction
GO:0043410	0.616	positive regulation of MAPK cascade
GO:0051896	0.565	regulation of protein kinase B signaling
GO:0046425	0.565	regulation of receptor signaling pathway via JAK-STAT
GO:0046427	0.538	positive regulation of receptor signaling pathway via JAK-STAT
GO:0032501	0.443	multicellular organismal process
GO:0048856	0.438	anatomical structure development
GO:0045944	0.414	positive regulation of transcription by RNA polymerase II
GO:0042221	0.413	response to chemical
GO:0002376	0.397	immune system process
GO:0008285	0.385	negative regulation of cell population proliferation
GO:0080135	0.365	regulation of cellular response to stress
GO:0050793	0.357	regulation of developmental process
GO:0007267	0.353	cell-cell signaling
GO:0070372	0.338	regulation of ERK1 and ERK2 cascade
GO:0051897	0.324	positive regulation of protein kinase B signaling
GO:0070302	0.317	regulation of stress-activated protein kinase signaling cascade
GO:0051246	0.315	regulation of protein metabolic process
GO:0006955	0.311	immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005737	0.997	cytoplasm
GO:0005829	0.990	cytosol
GO:0016020	0.338	membrane
GO:0071944	0.304	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]