StarFunc result for job id Q9NPI1

User Input

>input (651 residues)
MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKD
RKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKP
LTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFST
MKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSL
KQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD
MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPI
VGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEME
MSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAE
IFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV
TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPI1	1.000	1.000	1.654E-93	651	1.000	1.000	Q9NPI1.pdb.gz	BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1
2	AFDB:O88665	0.706	0.706	2.083E-84	651	0.882	0.882	O88665.pdb.gz	BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus OX=10090 GN=Brd7 PE=1 SV=1
3	AFDB:Q9VLX2	0.342	0.272	5.031E-28	861	0.281	0.213	Q9VLX2.pdb.gz	Q9VLX2_DROME Bromodomain containing 7/9 OS=Drosophila melanogaster OX=7227 GN=Brd7-9 PE=1 SV=1
4	AFDB:Q9H8M2	0.165	0.180	2.390E-21	597	0.321	0.350	Q9H8M2.pdb.gz	BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2
5	AFDB:F8W3C9	0.175	0.145	2.659E-9	811	0.146	0.117	F8W3C9.pdb.gz
6	AFDB:A0A024RCR5	0.133	0.110	4.120E-9	801	0.152	0.124	A0A024RCR5.pdb.gz
7	AFDB:Q9H0E9	0.144	0.080	1.165E-8	1235	0.163	0.086	Q9H0E9.pdb.gz	BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2
8	AFDB:Q9LM88	0.147	0.146	1.165E-8	652	0.127	0.127	Q9LM88.pdb.gz	Q9LM88_ARATH At1g20670 OS=Arabidopsis thaliana OX=3702 GN=At1g20670 PE=1 SV=1
9	AFDB:Q8AWX9	0.158	0.129	1.450E-8	806	0.141	0.114	Q8AWX9.pdb.gz
10	AFDB:Q07442	0.140	0.143	1.531E-8	638	0.157	0.160	Q07442.pdb.gz	BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDF2 PE=1 SV=1
11	PDB:6v8oO	0.214	0.340	4.220E-5	384	0.114	0.193	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
12	PDB:3javA	0.055	0.023	5.442E-1	2327	0.124	0.035	3javA.pdb.gz
13	PDB:3euhB	0.066	0.117	1.306	321	0.028	0.056	3euhB.pdb.gz
14	PDB:7dcoL	0.055	0.077	1.379	435	0.108	0.161	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:2w6gG	0.064	0.223	1.915	140	0.012	0.057	2w6gG.pdb.gz
16	PDB:5mpbV	0.072	0.140	2.660	289	0.020	0.045	5mpbV.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:6so5C	0.073	0.249	2.660	144	0.032	0.146	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
18	PDB:1pc2A	0.066	0.230	2.809	152	0.029	0.125	1pc2A.pdb.gz
19	PDB:7mq8LJ	0.069	0.089	2.809	469	0.032	0.045	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5gjqV	0.072	0.158	3.134	257	0.031	0.078	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88665	0.0	1181	651	0.882	0.882	BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus OX=10090 GN=Brd7 PE=1 SV=1
2	Q9NPI1	0.0	1345	651	1.000	1.000	BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1
3	Q9H8M2	2.15e-82	273	597	0.323	0.352	BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2
4	Q3UQU0	2.59e-82	273	596	0.330	0.361	BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus OX=10090 GN=Brd9 PE=1 SV=1
5	Q9VLX2	3.49e-66	235	861	0.276	0.209	Q9VLX2_DROME Bromodomain containing 7/9 OS=Drosophila melanogaster OX=7227 GN=Brd7-9 PE=1 SV=1
6	G5E8P1	4.28e-17	88.2	1058	0.063	0.039	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
7	O95696	4.35e-17	88.2	1058	0.065	0.040	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
8	D3ZUW8	4.63e-17	88.2	1189	0.063	0.034	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
9	Q9ULD4	6.99e-17	87.4	1205	0.097	0.052	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
10	B2RRD7	2.57e-16	85.5	1212	0.069	0.037	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
11	P55201	2.60e-16	85.5	1214	0.069	0.037	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
12	Q8VY17	7.92e-16	84.0	916	0.061	0.044	Q8VY17_ARATH DNA-binding bromodomain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g55040 PE=1 SV=1
13	Q7JVP4	7.14e-15	81.3	1430	0.057	0.026	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
14	A0A5F9ZH11	1.12e-14	80.5	1253	0.071	0.037	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
15	A4FVS4	3.28e-14	78.2	580	0.061	0.069	A4FVS4_ARATH At1g76380 OS=Arabidopsis thaliana OX=3702 GN=At1g76380 PE=1 SV=1
16	Q803M2	9.08e-14	77.4	899	0.063	0.046	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
17	Q9LM88	2.49e-13	75.5	652	0.057	0.057	Q9LM88_ARATH At1g20670 OS=Arabidopsis thaliana OX=3702 GN=At1g20670 PE=1 SV=1
18	Q9UUK2	4.49e-10	64.7	454	0.052	0.075	GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn5 PE=1 SV=1
19	P51123	1.54e-09	63.9	2129	0.046	0.014	TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster OX=7227 GN=Taf1 PE=1 SV=3
20	H7C179	3.55e-09	62.4	861	0.078	0.059	H7C179_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	2.6e-18	77.2	Bromodomain
2	PF12024 DUF3512	1.2e-66	235.5	Domain of unknown function (DUF3512)
3	PF00392 GntR	1.8e+02	13.2	Bacterial regulatory proteins, gntR family
4	PF01837 HcyBio	3.6e+02	11.4	Homocysteine biosynthesis enzyme, sulfur-incorporation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335044	0.999	AT-rich interactive domain-containing protein 2
2	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
3	9606.ENSP00000323967	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
4	9606.ENSP00000378414	0.992	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
5	9606.ENSP00000479526	0.990	Zinc finger protein DPF3
6	9606.ENSP00000378307	0.988	Protein polybromo-1
7	9606.ENSP00000341805	0.986	PHD finger protein 10
8	9606.ENSP00000267064	0.982	SWI/SNF complex subunit SMARCC2
9	9606.ENSP00000395654	0.981	Transcription activator BRG1
10	9606.ENSP00000263121	0.979	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
11	9606.ENSP00000397552	0.973	Actin-like protein 6A
12	9606.ENSP00000428056	0.965	Phosphatidylinositol 3-kinase regulatory subunit alpha
13	9606.ENSP00000310275	0.962	Barrier-to-autointegration factor
14	9606.ENSP00000254480	0.959	SWI/SNF complex subunit SMARCC1
15	9606.ENSP00000418960	0.954	Breast cancer type 1 susceptibility protein
16	9606.ENSP00000262188	0.945	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
17	9606.ENSP00000476960	0.940	Histone cluster 2 H3 pseudogene 2
18	9606.ENSP00000362592	0.939	Histone-binding protein RBBP4
19	9606.ENSP00000369716	0.936	Chromodomain-helicase-DNA-binding protein 3
20	9606.ENSP00000430432	0.932	Histone deacetylase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0003676	0.989	nucleic acid binding
GO:0003677	0.973	DNA binding
GO:0042393	0.869	histone binding
GO:0140030	0.792	modification-dependent protein binding
GO:0003713	0.789	transcription coactivator activity
GO:0043565	0.779	sequence-specific DNA binding
GO:0003690	0.755	double-stranded DNA binding
GO:0070577	0.735	lysine-acetylated histone binding
GO:0002039	0.719	p53 binding
GO:0000976	0.717	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0006338	0.985	chromatin remodeling
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0048523	0.979	negative regulation of cellular process
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0010605	0.961	negative regulation of macromolecule metabolic process
GO:0045934	0.956	negative regulation of nucleobase-containing compound metabolic process
GO:0051726	0.919	regulation of cell cycle
GO:1901987	0.895	regulation of cell cycle phase transition
GO:0045786	0.894	negative regulation of cell cycle
GO:0007346	0.855	regulation of mitotic cell cycle
GO:0009890	0.845	negative regulation of biosynthetic process
GO:0051253	0.839	negative regulation of RNA metabolic process
GO:0010948	0.806	negative regulation of cell cycle process
GO:0010558	0.799	negative regulation of macromolecule biosynthetic process
GO:0031327	0.797	negative regulation of cellular biosynthetic process
GO:0040029	0.786	epigenetic regulation of gene expression
GO:1902806	0.771	regulation of cell cycle G1/S phase transition
GO:1901988	0.769	negative regulation of cell cycle phase transition
GO:1901990	0.765	regulation of mitotic cell cycle phase transition
GO:0006357	0.760	regulation of transcription by RNA polymerase II
GO:0045930	0.757	negative regulation of mitotic cell cycle
GO:1903507	0.747	negative regulation of nucleic acid-templated transcription
GO:0045815	0.744	transcription initiation-coupled chromatin remodeling
GO:0045892	0.743	negative regulation of DNA-templated transcription
GO:1902807	0.722	negative regulation of cell cycle G1/S phase transition
GO:1901991	0.722	negative regulation of mitotic cell cycle phase transition
GO:2000045	0.692	regulation of G1/S transition of mitotic cell cycle
GO:2000134	0.665	negative regulation of G1/S transition of mitotic cell cycle
GO:0048522	0.325	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.981	cytosol
GO:0043232	0.726	intracellular non-membrane-bounded organelle
GO:0032991	0.463	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]