StarFunc result for job id Q9NPI5

User Input

>input (230 residues)
MKLIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESL
DMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLYSRRYFL
TVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMKSREELF
REVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPI5	1.000	1.000	1.281E-46	230	1.000	1.000	Q9NPI5.pdb.gz	NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens OX=9606 GN=NMRK2 PE=1 SV=1
2	AFDB:Q9D7C9	0.841	0.992	2.642E-37	195	0.717	0.846	Q9D7C9.pdb.gz	NRK2_MOUSE Nicotinamide riboside kinase 2 OS=Mus musculus OX=10090 GN=Nmrk2 PE=1 SV=1
3	AFDB:Q7ZUR6	0.821	0.928	1.011E-30	203	0.522	0.591	Q7ZUR6.pdb.gz	Q7ZUR6_DANRE Muscle-specific beta 1 integrin-binding protein 2 OS=Danio rerio OX=7955 GN=cb985 PE=2 SV=1
4	AFDB:Q9NWW6	0.773	0.888	6.819E-24	199	0.487	0.563	Q9NWW6.pdb.gz	NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens OX=9606 GN=NMRK1 PE=1 SV=1
5	PDB:2p0eA	0.741	0.893	1.853E-22	190	0.443	0.537	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
6	AFDB:Q9C0W1	0.670	0.670	1.407E-14	230	0.222	0.222	Q9C0W1.pdb.gz	NRK1_SCHPO Nicotinamide riboside kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nrk1 PE=3 SV=1
7	AFDB:P53915	0.698	0.670	1.676E-12	240	0.183	0.175	P53915.pdb.gz	NRK1_YEAST Nicotinamide riboside kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NRK1 PE=1 SV=1
8	AFDB:P67413	0.629	0.677	8.275E-11	212	0.165	0.179	P67413.pdb.gz	URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=udk PE=1 SV=1
9	AFDB:P0A8F4	0.589	0.631	1.064E-10	213	0.178	0.192	P0A8F4.pdb.gz	URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) OX=83333 GN=udk PE=3 SV=1
10	AFDB:P52623	0.512	0.439	1.760E-10	277	0.178	0.148	P52623.pdb.gz	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
11	AFDB:Q99PM9	0.594	0.530	5.815E-10	261	0.174	0.153	Q99PM9.pdb.gz	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
12	PDB:6pwzB	0.619	0.657	9.928E-10	215	0.161	0.172	6pwzB.pdb.gz	Incorporation of novel azido-nucleotides into RNA
13	PDB:1t3hC	0.427	0.509	1.095E-5	187	0.165	0.203	1t3hC.pdb.gz
14	PDB:1ukyA	0.472	0.540	1.166E-5	196	0.130	0.153	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
15	PDB:5xmbB	0.404	0.359	1.597E-5	267	0.139	0.120	5xmbB.pdb.gz
16	PDB:1vhlA	0.407	0.443	2.188E-5	208	0.165	0.183	1vhlA.pdb.gz	Structural analysis of a set of proteins resulting from a bacterial genomics project
17	PDB:1e2fA	0.465	0.500	3.618E-5	210	0.126	0.138	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
18	PDB:2iyvA	0.382	0.474	3.618E-5	179	0.152	0.196	2iyvA.pdb.gz	Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
19	PDB:1ko5A	0.442	0.558	7.228E-5	172	0.117	0.157	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
20	PDB:4tmkA	0.491	0.528	9.295E-5	210	0.113	0.124	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPI5	7.03e-176	483	230	1.000	1.000	NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens OX=9606 GN=NMRK2 PE=1 SV=1
2	Q9D7C9	2.67e-125	354	195	0.722	0.851	NRK2_MOUSE Nicotinamide riboside kinase 2 OS=Mus musculus OX=10090 GN=Nmrk2 PE=1 SV=1
3	Q7ZUR6	4.29e-92	271	203	0.522	0.591	Q7ZUR6_DANRE Muscle-specific beta 1 integrin-binding protein 2 OS=Danio rerio OX=7955 GN=cb985 PE=2 SV=1
4	Q9NWW6	6.70e-73	222	199	0.470	0.543	NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens OX=9606 GN=NMRK1 PE=1 SV=1
5	M0R0T8	3.88e-68	206	112	0.426	0.875	M0R0T8_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens OX=9606 GN=NMRK2 PE=1 SV=1
6	Q9C0W1	1.37e-18	83.2	230	0.230	0.230	NRK1_SCHPO Nicotinamide riboside kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nrk1 PE=3 SV=1
7	P53915	7.95e-10	59.3	240	0.217	0.208	NRK1_YEAST Nicotinamide riboside kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NRK1 PE=1 SV=1
8	P0A8F4	4.05e-06	48.5	213	0.161	0.174	URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) OX=83333 GN=udk PE=3 SV=1
9	Q8VYB2	0.005	39.7	466	0.122	0.060	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
10	Q9NWZ5	0.016	38.5	548	0.152	0.064	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
11	Q9FKS0	0.15	35.4	486	0.126	0.060	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
12	Q9LK34	0.16	35.4	483	0.143	0.068	UKL2_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL2 PE=1 SV=1
13	Q9C9B9	0.19	35.0	643	0.130	0.047	TTM1_ARATH Inorganic pyrophosphatase TTM1 OS=Arabidopsis thaliana OX=3702 GN=TTM1 PE=1 SV=1
14	Q9C664	0.38	34.3	674	0.057	0.019	TTM2_ARATH Inorganic pyrophosphatase TTM2 OS=Arabidopsis thaliana OX=3702 GN=TTM2 PE=1 SV=1
15	Q9HA47	0.69	33.1	277	0.130	0.108	UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
16	Q9BZX2	0.90	32.7	261	0.139	0.123	UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1
17	P52623	0.92	32.7	277	0.130	0.108	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
18	A6NNM8	1.1	32.7	815	0.109	0.031	TTL13_HUMAN Tubulin polyglutamylase TTLL13 OS=Homo sapiens OX=9606 GN=TTLL13 PE=1 SV=2
19	C1F5L9	1.2	32.3	345	0.100	0.067	C1F5L9_ACIC5 Protein RecA OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=ACP_3199 PE=3 SV=1
20	O74427	1.6	32.3	454	0.178	0.090	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13238 AAA_18	0.00027	32.9	AAA domain
2	PF13671 AAA_33	89	14.7	AAA domain
3	PF01926 MMR_HSR1	1.2	20.6	50S ribosome-binding GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000017480

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000026629	0.992	Nicotinamide nucleotide adenylyltransferase 3
2	9598.ENSPTRP00000002942	0.991	Nicotinamide nucleotide adenylyltransferase 2
3	9598.ENSPTRP00000052876	0.990	Nicotinamide-nucleotide adenylyltransferase
4	9598.ENSPTRP00000035321	0.947	Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D- ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate.
5	9598.ENSPTRP00000055668	0.938	Belongs to the NAPRTase family.
6	9598.ENSPTRP00000010346	0.935	Purine nucleoside phosphorylase
7	9598.ENSPTRP00000029297	0.919	Nudix (Nucleoside diphosphate linked moiety X)-type motif 12
8	9598.ENSPTRP00000060486	0.913	Nicotinamide-nucleotide adenylyltransferase
9	9598.ENSPTRP00000041745	0.900	Uncharacterized protein
10	9598.ENSPTRP00000049619	0.900	Uncharacterized protein
11	9598.ENSPTRP00000017483	0.797	Pan troglodytes death-associated protein kinase 3 (DAPK3), mRNA
12	9598.ENSPTRP00000017489	0.748	Protein inhibitor of activated STAT, 4
13	9598.ENSPTRP00000008700	0.714	NGFI-A binding protein 2 (EGR1 binding protein 2)
14	9598.ENSPTRP00000053555	0.703	Uncharacterized protein
15	9598.ENSPTRP00000000472	0.667	MICOS complex subunit MIC10
16	9598.ENSPTRP00000020305	0.619	Pan troglodytes family with sequence similarity 98, member A (FAM98A), mRNA
17	9598.ENSPTRP00000040181	0.614	Uncharacterized protein
18	9598.ENSPTRP00000017602	0.605	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]
19	9598.ENSPTRP00000061047	0.604	Secretory carrier-associated membrane protein
20	9598.ENSPTRP00000037904	0.596	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0050262	0.685	ribosylnicotinamide kinase activity
GO:0061769	0.618	ribosylnicotinate kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006163	0.987	purine nucleotide metabolic process
GO:0072524	0.971	pyridine-containing compound metabolic process
GO:0046496	0.956	nicotinamide nucleotide metabolic process
GO:0019674	0.905	NAD metabolic process
GO:0050789	0.538	regulation of biological process
GO:0050794	0.530	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0071944	0.990	cell periphery
GO:0016020	0.985	membrane
GO:0005886	0.982	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:14017	0.685	ATP + beta-nicotinamide D-riboside = ADP + beta-nicotinamide D-ribonucleotide + H(+)
EC:2.7.1.22	0.685	ribosylnicotinamide kinase.

[back to server]