StarFunc result for job id Q9NPI6

User Input

>input (582 residues)
MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRS
ASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAK
LMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISS
PGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSE
EMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASIT
QSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPV
PELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS
FSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSS
AIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSI
ILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPI6	0.999	0.999	8.861E-79	582	1.000	1.000	Q9NPI6.pdb.gz	DCP1A_HUMAN mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3
2	AFDB:Q91YD3	0.500	0.485	6.621E-72	602	0.892	0.862	Q91YD3.pdb.gz	DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus OX=10090 GN=Dcp1a PE=1 SV=1
3	AFDB:Q8IZD4	0.248	0.235	1.849E-28	617	0.296	0.279	Q8IZD4.pdb.gz	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
4	AFDB:Q3U564	0.256	0.257	3.339E-27	578	0.297	0.299	Q3U564.pdb.gz	DCP1B_MOUSE mRNA-decapping enzyme 1B OS=Mus musculus OX=10090 GN=Dcp1b PE=1 SV=1
5	PDB:2qkmG	0.197	0.855	9.606E-12	127	0.065	0.299	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
6	PDB:1q67B	0.184	0.643	5.649E-11	161	0.045	0.161	1q67B.pdb.gz
7	PDB:6am0F	0.203	0.650	8.051E-11	178	0.045	0.146	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
8	AFDB:Q8T4F7	0.171	0.103	1.392E-6	980	0.179	0.106	Q8T4F7.pdb.gz	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
9	AFDB:Q12446	0.176	0.163	4.031E-6	633	0.191	0.175	Q12446.pdb.gz	LAS17_YEAST Proline-rich protein LAS17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS17 PE=1 SV=1
10	PDB:3m1iB	0.178	0.714	6.374E-6	131	0.019	0.084	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
11	PDB:1k5dB	0.163	0.586	1.846E-4	146	0.021	0.082	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
12	PDB:2kr0A	0.134	0.183	2.482E-3	407	0.058	0.084	2kr0A.pdb.gz
13	AFDB:Q9QYY0	0.137	0.118	2.671E-3	695	0.119	0.099	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
14	PDB:6oxlN	0.155	0.561	2.963E-3	124	0.029	0.137	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
15	AFDB:F1Q7S5	0.157	0.129	3.188E-3	740	0.127	0.100	F1Q7S5.pdb.gz	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
16	PDB:5yqrA	0.128	0.253	3.537E-3	268	0.017	0.037	5yqrA.pdb.gz
17	PDB:6xtbE	0.116	0.244	3.980E-3	235	0.024	0.060	6xtbE.pdb.gz
18	AFDB:Q38AE6	0.134	0.072	4.283E-3	1203	0.180	0.087	Q38AE6.pdb.gz	Q38AE6_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2340 PE=4 SV=1
19	AFDB:Q382R7	0.125	0.081	6.870E-3	974	0.127	0.076	Q382R7.pdb.gz	Q382R7_TRYB2 PH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4480 PE=4 SV=1
20	PDB:4mk0A	0.129	0.121	1.222E-2	631	0.034	0.032	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6APY3	0.0	932	543	0.816	0.875	A0A8I6APY3_RAT 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase OS=Rattus norvegicus OX=10116 GN=Dcp1a PE=1 SV=1
2	D4AE80	0.0	1020	601	0.876	0.849	D4AE80_RAT 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase OS=Rattus norvegicus OX=10116 GN=Dcp1a PE=1 SV=1
3	Q91YD3	0.0	1036	602	0.893	0.864	DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus OX=10090 GN=Dcp1a PE=1 SV=1
4	Q9NPI6	0.0	1184	582	1.000	1.000	DCP1A_HUMAN mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3
5	Q8IZD4	2.02e-61	216	617	0.167	0.157	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
6	Q3U564	1.28e-59	210	578	0.162	0.163	DCP1B_MOUSE mRNA-decapping enzyme 1B OS=Mus musculus OX=10090 GN=Dcp1b PE=1 SV=1
7	Q9W1H5	6.46e-36	140	372	0.137	0.215	Q9W1H5_DROME Decapping protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=DCP1 PE=1 SV=1
8	Q9SJF3	9.47e-27	114	367	0.082	0.131	DCP1_ARATH mRNA-decapping enzyme-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g08370 PE=1 SV=2
9	Q9P805	1.57e-13	69.7	127	0.064	0.291	DCP1_SCHPO mRNA-decapping enzyme subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcp1 PE=1 SV=1
10	Q9N363	5.06e-10	63.5	332	0.053	0.093	DCP1_CAEEL mRNA-decapping enzyme 1 OS=Caenorhabditis elegans OX=6239 GN=dcap-1 PE=1 SV=1
11	M9PCJ6	0.094	38.5	18641	0.112	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PC48	0.095	38.5	18095	0.112	0.004	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	Q8WXE9	0.45	36.2	905	0.048	0.031	STON2_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1
14	A0A3B3IU55	0.60	35.8	977	0.048	0.029	A0A3B3IU55_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1
15	C8ZHG8	1.9	33.1	231	0.024	0.061	C8ZHG8_YEAS8 Dcp1p OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=EC1118_1O4_0144g PE=3 SV=1
16	Q12517	1.9	33.1	231	0.024	0.061	DCP1_YEAST mRNA-decapping enzyme subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCP1 PE=1 SV=1
17	O36027	2.9	33.1	574	0.034	0.035	WSP1_SCHPO Actin-binding protein wsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wsp1 PE=1 SV=3
18	O77375	4.5	32.7	2457	0.046	0.011	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
19	O74733	5.0	32.7	1441	0.052	0.021	CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cft1 PE=3 SV=1
20	C6KTF9	5.6	32.7	2238	0.038	0.010	C6KTF9_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0632800 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06058 DCP1	4.9e-37	137.8	Dcp1-like decapping family
2	PF16741 mRNA_decap_C	4.5e-16	69.2	mRNA-decapping enzyme C-terminus
3	PF00568 WH1	4.7e+02	12.1	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003818780.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003826779.1	0.985	Decapping mRNA 2
2	9597.XP_003811150.1	0.984	Enhancer of mRNA decapping 3
3	9597.XP_003820080.1	0.981	DEAD-box helicase 6
4	9597.XP_008962822.1	0.976	Enhancer of mRNA decapping 4
5	9597.XP_008961380.1	0.975	Proline rich nuclear receptor coactivator 2
6	9597.XP_003820412.1	0.973	mRNA-decapping enzyme 1B
7	9597.XP_008950164.1	0.973	5'-3' exoribonuclease 1 isoform X1
8	9597.XP_008950853.1	0.925	SMAD family member 4
9	9597.XP_008969267.1	0.915	UPF1, RNA helicase and ATPase
10	9597.XP_003826409.1	0.913	PAT1 homolog 1, processing body mRNA decay factor
11	9597.XP_003817824.1	0.867	Binds specifically to the 3'-terminal U-tract of U6 snRNA.
12	9597.XP_003830782.1	0.852	Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation
13	9597.XP_008967541.1	0.851	Nudix hydrolase 19
14	9597.XP_003821095.1	0.850	Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX
15	9597.XP_008969225.1	0.850	yjeF N-terminal domain-containing protein 3 isoform X1
16	9597.XP_008967491.1	0.822	LSM14A, mRNA processing body assembly factor
17	9597.XP_003826280.1	0.807	LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
18	9597.XP_003831598.1	0.797	LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
19	9597.XP_008970550.1	0.793	Belongs to the protein kinase superfamily.
20	9597.XP_003810676.1	0.791	Possesses 5'->3' exoribonuclease activity. May promote termination of transcription by RNA polymerase II.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019894	0.362	kinesin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044237	0.990	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0016070	0.983	RNA metabolic process
GO:0110156	0.947	methylguanosine-cap decapping
GO:0051641	0.934	cellular localization
GO:0033036	0.795	macromolecule localization
GO:0033365	0.792	protein localization to organelle
GO:0050789	0.538	regulation of biological process
GO:0050794	0.521	regulation of cellular process
GO:0019222	0.457	regulation of metabolic process
GO:0060255	0.452	regulation of macromolecule metabolic process
GO:0080090	0.450	regulation of primary metabolic process
GO:0051171	0.450	regulation of nitrogen compound metabolic process
GO:0048518	0.439	positive regulation of biological process
GO:0048522	0.425	positive regulation of cellular process
GO:0031323	0.375	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036464	1.000	cytoplasmic ribonucleoprotein granule
GO:0005829	0.987	cytosol
GO:0016020	0.960	membrane
GO:0043231	0.848	intracellular membrane-bounded organelle
GO:0070013	0.782	intracellular organelle lumen
GO:0000932	0.548	P-body
GO:0005634	0.472	nucleus
GO:0031981	0.310	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]