StarFunc result for job id Q9NPL8

User Input

>input (285 residues)
MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRE
LFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAV
QSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFR
INVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRL
QVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPL8	1.000	1.000	5.839E-39	285	1.000	1.000	Q9NPL8.pdb.gz	TIDC1_HUMAN Complex I assembly factor TIMMDC1, mitochondrial OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=2
2	AFDB:Q8BUY5	0.782	0.782	8.508E-28	285	0.712	0.712	Q8BUY5.pdb.gz	TIDC1_MOUSE Complex I assembly factor TIMMDC1, mitochondrial OS=Mus musculus OX=10090 GN=Timmdc1 PE=1 SV=1
3	AFDB:Q9USM7	0.408	0.541	5.117E-6	210	0.116	0.157	Q9USM7.pdb.gz	TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim23 PE=3 SV=1
4	AFDB:Q9CQ85	0.383	0.539	1.464E-5	194	0.137	0.201	Q9CQ85.pdb.gz	TIM22_MOUSE Mitochondrial import inner membrane translocase subunit Tim22 OS=Mus musculus OX=10090 GN=Timm22 PE=1 SV=1
5	AFDB:Q59YG5	0.401	0.514	2.751E-5	218	0.130	0.170	Q59YG5.pdb.gz	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
6	AFDB:Q382K7	0.297	0.491	2.900E-5	152	0.095	0.178	Q382K7.pdb.gz	Q382K7_TRYB2 Mitochondrial import inner membrane translocase subunit TIM22 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4870 PE=3 SV=1
7	AFDB:P87146	0.341	0.520	4.416E-5	175	0.091	0.149	P87146.pdb.gz	TIM22_SCHPO Mitochondrial import inner membrane translocase subunit tim22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim22 PE=3 SV=1
8	AFDB:A0A1D8PI78	0.375	0.547	5.170E-5	184	0.088	0.136	A0A1D8PI78.pdb.gz	TIM22_CANAL Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM22 PE=1 SV=1
9	AFDB:O35092	0.393	0.633	7.469E-5	171	0.084	0.140	O35092.pdb.gz	TI17A_RAT Mitochondrial import inner membrane translocase subunit Tim17-A OS=Rattus norvegicus OX=10116 GN=Timm17a PE=2 SV=1
10	AFDB:Q9XVQ2	0.347	0.397	9.217E-5	242	0.126	0.149	Q9XVQ2.pdb.gz	Q9XVQ2_CAEEL Mitochondrial import inner membrane translocase subunit TIM23 OS=Caenorhabditis elegans OX=6239 GN=timm-23 PE=1 SV=1
11	PDB:7cgpA	0.294	0.491	5.347E-3	147	0.119	0.231	7cgpA.pdb.gz
12	PDB:6lo8A	0.223	0.470	2.211E-2	129	0.084	0.186	6lo8A.pdb.gz
13	PDB:7psaY	0.201	0.364	2.615E-1	140	0.084	0.171	7psaY.pdb.gz	Cryo-electron microscopy reveals how acetogenins inhibit mitochondrial respiratory complex I.
14	PDB:6gciA	0.261	0.255	3.982E-1	292	0.060	0.058	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
15	PDB:7pp4f	0.139	0.207	3.982E-1	142	0.074	0.148	7pp4f.pdb.gz	Mycobacterium RbpA cooperates with the stress-response sigma-B subunit of RNA polymerase in promoter DNA unwinding.
16	PDB:5xtcV	0.236	0.412	1.201	140	0.060	0.121	5xtcV.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:6ikoA	0.186	0.180	2.031	303	0.074	0.069	6ikoA.pdb.gz
18	PDB:6lthN	0.131	0.142	2.141	261	0.102	0.111	6lthN.pdb.gz	Structure of nucleosome-bound human BAF complex.
19	PDB:7xw5R	0.103	0.058	2.935	572	0.077	0.038	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.
20	PDB:7egmE	0.174	0.125	3.260	422	0.098	0.066	7egmE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPL8	0.0	590	285	1.000	1.000	TIDC1_HUMAN Complex I assembly factor TIMMDC1, mitochondrial OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=2
2	Q8BUY5	2.76e-146	413	285	0.712	0.712	TIDC1_MOUSE Complex I assembly factor TIMMDC1, mitochondrial OS=Mus musculus OX=10090 GN=Timmdc1 PE=1 SV=1
3	C9JU35	5.40e-54	174	151	0.302	0.570	C9JU35_HUMAN Translocase of inner mitochondrial membrane domain containing 1 OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=1
4	Q9USM7	0.030	37.4	210	0.105	0.143	TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim23 PE=3 SV=1
5	P32897	0.038	37.0	222	0.102	0.131	TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM23 PE=1 SV=1
6	Q7PLT4	0.13	35.0	173	0.070	0.116	Q7PLT4_DROME Translocase of the inner mitochondrial membrane 17b, isoform A OS=Drosophila melanogaster OX=7227 GN=Tim17b PE=1 SV=1
7	F4JH53	1.1	33.1	635	0.084	0.038	FDM2_ARATH Factor of DNA methylation 2 OS=Arabidopsis thaliana OX=3702 GN=FDM2 PE=1 SV=1
8	O60830	1.3	32.0	172	0.063	0.105	TI17B_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-B OS=Homo sapiens OX=9606 GN=TIMM17B PE=1 SV=1
9	Q9Z0V7	1.5	32.0	172	0.109	0.180	TI17B_MOUSE Mitochondrial import inner membrane translocase subunit Tim17-B OS=Mus musculus OX=10090 GN=Timm17b PE=1 SV=1
10	O94506	1.9	32.3	296	0.056	0.054	RSM1_SCHPO mRNA export factor rsm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsm1 PE=4 SV=1
11	Q7T2P6	2.4	31.6	208	0.060	0.082	TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio OX=7955 GN=timm23 PE=2 SV=1
12	Q9LN27	2.5	31.6	218	0.074	0.096	TI171_ARATH Mitochondrial import inner membrane translocase subunit TIM17-1 OS=Arabidopsis thaliana OX=3702 GN=TIM17-1 PE=2 SV=1
13	Q9S9P3	2.7	32.0	634	0.070	0.032	FDM1_ARATH Factor of DNA methylation 1 OS=Arabidopsis thaliana OX=3702 GN=FDM1 PE=1 SV=1
14	Q9SP35	3.7	31.2	243	0.070	0.082	TI172_ARATH Mitochondrial import inner membrane translocase subunit TIM17-2 OS=Arabidopsis thaliana OX=3702 GN=TIM17-2 PE=1 SV=2
15	O35093	3.8	30.8	209	0.081	0.110	TIM23_RAT Mitochondrial import inner membrane translocase subunit Tim23 OS=Rattus norvegicus OX=10116 GN=Timm23 PE=2 SV=1
16	Q59YG5	4.5	30.8	218	0.049	0.064	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
17	Q9XVQ2	4.5	30.8	242	0.060	0.070	Q9XVQ2_CAEEL Mitochondrial import inner membrane translocase subunit TIM23 OS=Caenorhabditis elegans OX=6239 GN=timm-23 PE=1 SV=1
18	O14925	6.2	30.4	209	0.063	0.086	TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens OX=9606 GN=TIMM23 PE=1 SV=1
19	Q6ZRS2	6.8	30.8	3230	0.063	0.006	SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3
20	Q9WTQ8	8.2	30.0	209	0.063	0.086	TIM23_MOUSE Mitochondrial import inner membrane translocase subunit Tim23 OS=Mus musculus OX=10090 GN=Timm23 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05433 Rick_17kDa_Anti	6.4e+02	11.6	Glycine zipper 2TM domain
2	PF02466 Tim17	2.9e-14	64.8	Tim17/Tim22/Tim23/Pmp24 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418803

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351737	0.999	Complex I assembly factor TMEM126B, mitochondrial
2	9606.ENSP00000358272	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4
3	9606.ENSP00000260361	0.998	Complex I intermediate-associated protein 30, mitochondrial
4	9606.ENSP00000270517	0.998	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
5	9606.ENSP00000312618	0.998	Acyl-CoA dehydrogenase family member 9, mitochondrial
6	9606.ENSP00000323076	0.986	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
7	9606.ENSP00000356972	0.977	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
8	9606.ENSP00000362873	0.977	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
9	9606.ENSP00000423673	0.974	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
10	9606.ENSP00000259037	0.973	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
11	9606.ENSP00000299166	0.973	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
12	9606.ENSP00000369176	0.973	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
13	9606.ENSP00000233627	0.972	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
14	9606.ENSP00000315774	0.972	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
15	9606.ENSP00000354687	0.972	NADH-ubiquinone oxidoreductase chain 1
16	9606.ENSP00000268668	0.965	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
17	9606.ENSP00000354961	0.965	NADH-ubiquinone oxidoreductase chain 4
18	9606.ENSP00000184266	0.964	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
19	9606.ENSP00000266544	0.964	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
20	9606.ENSP00000276689	0.964	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.450	transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007005	0.996	mitochondrion organization
GO:0051234	0.964	establishment of localization
GO:0044085	0.687	cellular component biogenesis
GO:0022607	0.635	cellular component assembly
GO:0043933	0.535	protein-containing complex organization
GO:0065003	0.521	protein-containing complex assembly
GO:0006810	0.428	transport
GO:0046907	0.418	intracellular transport
GO:0033108	0.412	mitochondrial respiratory chain complex assembly
GO:0071702	0.403	organic substance transport
GO:0032981	0.382	mitochondrial respiratory chain complex I assembly
GO:0071705	0.366	nitrogen compound transport
GO:0070585	0.345	protein localization to mitochondrion
GO:0006839	0.329	mitochondrial transport
GO:0072655	0.327	establishment of protein localization to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.998	intracellular organelle lumen
GO:0005743	0.998	mitochondrial inner membrane
GO:0005654	0.992	nucleoplasm
GO:0032991	0.846	protein-containing complex
GO:0098798	0.566	mitochondrial protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]