StarFunc result for job id Q9NPP4

User Input

>input (1024 residues)
MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPL
GEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQ
RIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLR
QRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDM
TEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQT
TLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSI
SDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNT
TEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFE
HLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFR
TLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVE
ASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDA
IKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLL
KHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGV
FENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFK
LVTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UP24	0.826	0.826	0.000	1024	0.750	0.750	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
2	AFDB:Q9NPP4	1.000	1.000	0.000	1024	1.000	1.000	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
3	PDB:4kxfP	0.809	0.952	2.371E-96	866	0.645	0.762	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
4	PDB:3jblA	0.614	0.686	3.230E-80	909	0.680	0.766	3jblA.pdb.gz
5	AFDB:M0R915	0.530	0.397	8.087E-47	1403	0.218	0.159	M0R915.pdb.gz	M0R915_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=3
6	AFDB:Q9QWK5	0.523	0.392	1.833E-44	1403	0.218	0.159	Q9QWK5.pdb.gz	BIR1A_MOUSE Baculoviral IAP repeat-containing protein 1a OS=Mus musculus OX=10090 GN=Naip1 PE=2 SV=3
7	AFDB:Q9QUK4	0.518	0.377	2.579E-44	1447	0.226	0.160	Q9QUK4.pdb.gz	BIR1B_MOUSE Baculoviral IAP repeat-containing protein 1b OS=Mus musculus OX=10090 GN=Naip2 PE=1 SV=2
8	AFDB:Q9JIB6	0.521	0.392	2.691E-44	1403	0.232	0.170	Q9JIB6.pdb.gz	BIR1F_MOUSE Baculoviral IAP repeat-containing protein 1f OS=Mus musculus OX=10090 GN=Naip6 PE=1 SV=2
9	AFDB:Q13075	0.510	0.384	2.487E-42	1403	0.217	0.158	Q13075.pdb.gz	BIRC1_HUMAN Baculoviral IAP repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NAIP PE=1 SV=3
10	PDB:6b5bA	0.496	0.431	3.080E-30	1199	0.202	0.173	6b5bA.pdb.gz
11	AFDB:E9Q5R7	0.381	0.371	6.689E-27	1054	0.161	0.157	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
12	AFDB:D4ADT7	0.353	0.377	6.981E-27	953	0.172	0.185	D4ADT7.pdb.gz	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
13	AFDB:A0A0K0KIB0	0.372	0.396	8.281E-27	954	0.169	0.181	A0A0K0KIB0.pdb.gz	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
14	PDB:5yudA	0.488	0.413	2.546E-23	1238	0.205	0.170	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
15	PDB:7pzcA	0.387	0.392	2.464E-20	1010	0.157	0.159	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
16	PDB:7lfhA	0.327	0.405	7.214E-18	806	0.161	0.205	7lfhA.pdb.gz
17	PDB:6npyA	0.315	0.391	1.433E-16	798	0.144	0.184	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
18	PDB:6j5wA	0.200	0.234	8.818E-9	816	0.109	0.137	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
19	PDB:6mksA	0.087	0.969	2.162E-8	90	0.088	1.000	6mksA.pdb.gz
20	PDB:3oglB	0.233	0.364	3.609E-8	568	0.072	0.130	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UP24	0.0	1593	1024	0.750	0.750	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
2	Q9NPP4	0.0	2111	1024	1.000	1.000	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
3	Q9JIB6	2.05e-52	203	1403	0.241	0.176	BIR1F_MOUSE Baculoviral IAP repeat-containing protein 1f OS=Mus musculus OX=10090 GN=Naip6 PE=1 SV=2
4	Q13075	2.93e-52	202	1403	0.231	0.169	BIRC1_HUMAN Baculoviral IAP repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NAIP PE=1 SV=3
5	Q9QUK4	4.02e-49	192	1447	0.232	0.164	BIR1B_MOUSE Baculoviral IAP repeat-containing protein 1b OS=Mus musculus OX=10090 GN=Naip2 PE=1 SV=2
6	Q9R016	1.70e-47	187	1403	0.222	0.162	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3
7	Q9QWK5	8.32e-44	176	1403	0.120	0.088	BIR1A_MOUSE Baculoviral IAP repeat-containing protein 1a OS=Mus musculus OX=10090 GN=Naip1 PE=2 SV=3
8	M0R915	1.85e-39	162	1414	0.115	0.083	M0R915_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=3
9	A0A8I5ZWN7	2.15e-39	161	1358	0.115	0.087	A0A8I5ZWN7_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=1
10	Q7RTR0	7.32e-06	52.8	991	0.091	0.094	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
11	Q9HC29	8.85e-06	52.4	1040	0.092	0.090	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
12	Q9NX02	8.97e-06	52.4	1062	0.184	0.177	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
13	Q80SY9	9.26e-06	52.4	1013	0.076	0.077	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
14	Q8K3Z0	1.04e-05	52.0	1020	0.076	0.076	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
15	J3KN39	1.21e-05	52.0	1059	0.184	0.178	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
16	A0A060X8V7	2.22e-05	51.2	951	0.062	0.067	A0A060X8V7_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00047677001 PE=4 SV=1
17	Q8R4B8	2.33e-05	50.8	1033	0.075	0.075	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
18	A0A0K0KIB0	2.61e-05	50.8	954	0.062	0.067	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
19	Q6E804	2.74e-05	50.8	1013	0.080	0.081	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
20	Q9Y239	4.46e-05	50.1	953	0.068	0.073	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.1e+02	13.7	AAA ATPase domain
2	PF13401 AAA_22	5.7e+02	12.2	AAA domain
3	PF00619 CARD	3e-18	76.9	Caspase recruitment domain
4	PF13855 LRR_8	9.2e+02	11.0	Leucine rich repeat
5	PF05729 NACHT	6.5e-30	115.7	NACHT domain
6	PF17889 NLRC4_HD	4.4e-31	118.8	NLRC4 helical domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.999	Caspase-1
2	9606.ENSP00000337383	0.998	NACHT, LRR and PYD domains-containing protein 3
3	9606.ENSP00000357112	0.997	Interferon-inducible protein AIM2
4	9606.ENSP00000478516	0.996	NACHT, LRR and PYD domains-containing protein 1
5	9606.ENSP00000247470	0.989	Apoptosis-associated speck-like protein containing a CARD
6	9606.ENSP00000309767	0.979	NACHT, LRR and PYD domains-containing protein 6
7	9606.ENSP00000428657	0.978	Baculoviral IAP repeat-containing protein 1
8	9606.ENSP00000351273	0.952	Caspase-8
9	9606.ENSP00000433209	0.949	Gasdermin-D
10	9606.ENSP00000355231	0.944	Beclin-1
11	9606.ENSP00000376849	0.943	Caspase-5
12	9606.ENSP00000269305	0.915	Cellular tumor antigen p53
13	9606.ENSP00000378217	0.908	Protein kinase C delta type
14	9606.ENSP00000219596	0.883	Pyrin
15	9606.ENSP00000375767	0.875	Caspase recruitment domain-containing protein 8
16	9606.ENSP00000280357	0.868	Interleukin-18
17	9606.ENSP00000339479	0.857	Cytosolic purine 5'-nucleotidase
18	9606.ENSP00000359385	0.847	Glomulin
19	9606.ENSP00000263341	0.840	Interleukin-1 beta
20	9606.ENSP00000440643	0.839	Toll-like receptor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0019899	0.869	enzyme binding
GO:1901363	0.775	heterocyclic compound binding
GO:0097159	0.775	organic cyclic compound binding
GO:0097367	0.768	carbohydrate derivative binding
GO:0046983	0.748	protein dimerization activity
GO:0098772	0.708	molecular function regulator activity
GO:0089720	0.581	caspase binding
GO:0043167	0.558	ion binding
GO:0140677	0.534	molecular function activator activity
GO:0030234	0.476	enzyme regulator activity
GO:0061134	0.464	peptidase regulator activity
GO:0035639	0.456	purine ribonucleoside triphosphate binding
GO:0032555	0.453	purine ribonucleotide binding
GO:0042803	0.421	protein homodimerization activity
GO:0030554	0.415	adenyl nucleotide binding
GO:0005524	0.406	ATP binding
GO:0016504	0.398	peptidase activator activity
GO:0061135	0.361	endopeptidase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0009605	0.990	response to external stimulus
GO:0050794	0.990	regulation of cellular process
GO:0032651	0.990	regulation of interleukin-1 beta production
GO:2000116	0.990	regulation of cysteine-type endopeptidase activity
GO:0032732	0.990	positive regulation of interleukin-1 production
GO:0006950	0.988	response to stress
GO:0006952	0.983	defense response
GO:0051707	0.983	response to other organism
GO:0043281	0.983	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009595	0.982	detection of biotic stimulus
GO:0032731	0.982	positive regulation of interleukin-1 beta production
GO:0008152	0.973	metabolic process
GO:0009617	0.972	response to bacterium
GO:0010952	0.970	positive regulation of peptidase activity
GO:0098542	0.969	defense response to other organism
GO:0043067	0.964	regulation of programmed cell death
GO:0098581	0.961	detection of external biotic stimulus
GO:0042742	0.955	defense response to bacterium
GO:0051090	0.953	regulation of DNA-binding transcription factor activity
GO:2001056	0.935	positive regulation of cysteine-type endopeptidase activity
GO:0048522	0.933	positive regulation of cellular process
GO:0051091	0.926	positive regulation of DNA-binding transcription factor activity
GO:0009987	0.921	cellular process
GO:0010942	0.901	positive regulation of cell death
GO:0071704	0.874	organic substance metabolic process
GO:0044238	0.867	primary metabolic process
GO:0043280	0.865	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1901564	0.844	organonitrogen compound metabolic process
GO:0048583	0.836	regulation of response to stimulus
GO:0043170	0.836	macromolecule metabolic process
GO:0042981	0.835	regulation of apoptotic process
GO:0019538	0.830	protein metabolic process
GO:1903317	0.814	regulation of protein maturation
GO:0051092	0.729	positive regulation of NF-kappaB transcription factor activity
GO:0048584	0.728	positive regulation of response to stimulus
GO:0006919	0.711	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002376	0.669	immune system process
GO:0051716	0.658	cellular response to stimulus
GO:0070613	0.598	regulation of protein processing
GO:0080134	0.548	regulation of response to stress
GO:0031349	0.529	positive regulation of defense response
GO:0032103	0.492	positive regulation of response to external stimulus
GO:0050778	0.489	positive regulation of immune response
GO:0043068	0.467	positive regulation of programmed cell death
GO:0007154	0.435	cell communication
GO:0012501	0.428	programmed cell death
GO:0002831	0.425	regulation of response to biotic stimulus
GO:0043065	0.423	positive regulation of apoptotic process
GO:0042221	0.415	response to chemical
GO:0010033	0.409	response to organic substance
GO:0071840	0.384	cellular component organization or biogenesis
GO:0023052	0.381	signaling
GO:0006508	0.374	proteolysis
GO:0051604	0.372	protein maturation
GO:0007165	0.361	signal transduction
GO:0048519	0.355	negative regulation of biological process
GO:0009966	0.348	regulation of signal transduction
GO:0016043	0.342	cellular component organization
GO:0006955	0.328	immune response
GO:1903319	0.311	positive regulation of protein maturation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.979	organelle
GO:0043229	0.962	intracellular organelle
GO:0043227	0.960	membrane-bounded organelle
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0032991	0.930	protein-containing complex
GO:0016020	0.465	membrane
GO:0005634	0.419	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]