StarFunc result for job id Q9NPU4

User Input

>input (83 residues)
MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAANGQGQPEDPPRSSNDAVL
LWIAIIATLGNIVVVGVVYAFTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38389	0.301	0.304	2.321	82	0.145	0.146	P38389.pdb.gz	SC61B_ARATH Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana OX=3702 GN=At2g45070 PE=1 SV=1
2	AFDB:Q39067	0.241	0.077	3.199	445	0.096	0.018	Q39067.pdb.gz	CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-2 PE=1 SV=2
3	AFDB:Q384Q8	0.245	0.100	4.069	252	0.145	0.048	Q384Q8.pdb.gz	Q384Q8_TRYB2 V-type proton ATPase proteolipid subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5470 PE=3 SV=1
4	PDB:7dcoL	0.255	0.064	4.403	435	0.108	0.021	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
5	AFDB:Q38FS2	0.225	0.071	4.777	323	0.169	0.043	Q38FS2.pdb.gz	Q38FS2_TRYB2 Electon transport protein SCO1/SCO2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1140 PE=3 SV=1
6	AFDB:Q8H5X5	0.301	0.112	5.176	306	0.120	0.033	Q8H5X5.pdb.gz	SCAM1_ORYSJ Secretory carrier-associated membrane protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SCAMP1 PE=2 SV=1
7	AFDB:A0A140VK60	0.203	0.124	6.076	180	0.072	0.033	A0A140VK60.pdb.gz	A0A140VK60_HUMAN Testis tissue sperm-binding protein Li 93mP OS=Homo sapiens OX=9606 PE=2 SV=1
8	AFDB:A0A9K8	0.432	0.319	6.076	120	0.205	0.142	A0A9K8.pdb.gz	A0A9K8_ASPOZ Synaptobrevin OS=Aspergillus oryzae OX=5062 GN=Aosnc1 PE=4 SV=1
9	AFDB:Q7L0Y3	0.189	0.064	6.583	403	0.120	0.025	Q7L0Y3.pdb.gz	TM10C_HUMAN tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2
10	AFDB:G5BQH5	0.233	0.080	7.133	264	0.120	0.038	G5BQH5.pdb.gz	APOA1_HETGA Apolipoprotein A-I OS=Heterocephalus glaber OX=10181 GN=Apoa1 PE=1 SV=2
11	AFDB:P75936	0.254	0.097	7.133	231	0.157	0.056	P75936.pdb.gz	FLGD_ECOLI Basal-body rod modification protein FlgD OS=Escherichia coli (strain K12) OX=83333 GN=flgD PE=3 SV=1
12	PDB:5yzgL	0.236	0.056	7.718	419	0.217	0.043	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6hivCv	0.205	0.024	9.816	1059	0.181	0.014	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:7abzG	0.160	0.096	9.816	149	0.145	0.081	7abzG.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z2X2	0.056	33.1	4749	0.229	0.004	DNHD1_MOUSE Dynein heavy chain domain-containing protein 1 OS=Mus musculus OX=10090 GN=Dnhd1 PE=1 SV=3
2	Q4KN81	0.26	31.2	360	0.193	0.044	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
3	O43898	0.49	30.4	376	0.229	0.051	O43898_HUMAN High-affinity lysophosphatidic acid receptor homolog OS=Homo sapiens OX=9606 PE=2 SV=1
4	Q9Y5Y3	0.56	30.4	372	0.229	0.051	GPR45_HUMAN Probable G-protein coupled receptor 45 OS=Homo sapiens OX=9606 GN=GPR45 PE=1 SV=2
5	G3UY91	0.77	28.9	76	0.157	0.171	G3UY91_MOUSE Histocompatibility 2, Q region locus 2 (Fragment) OS=Mus musculus OX=10090 GN=H2-Q2 PE=4 SV=1
6	Q31198	1.3	27.7	39	0.145	0.308	Q31198_MOUSE MHC class I Tla-37-like (Fragment) OS=Mus musculus OX=10090 GN=H2-Q2 PE=2 SV=1
7	C0LGU0	3.2	28.1	662	0.145	0.018	PRK1_ARATH Pollen receptor-like kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PRK1 PE=1 SV=1
8	A0A1D8PQK6	3.6	28.1	917	0.157	0.014	A0A1D8PQK6_CANAL Calcium-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMR1 PE=3 SV=1
9	P46953	4.0	27.7	286	0.229	0.066	3HAO_RAT 3-hydroxyanthranilate 3,4-dioxygenase OS=Rattus norvegicus OX=10116 GN=Haao PE=1 SV=2
10	B5XK69	4.5	27.7	590	0.181	0.025	OLHYD_STRPZ Oleate hydratase OS=Streptococcus pyogenes serotype M49 (strain NZ131) OX=471876 GN=sph PE=1 SV=2
11	Q61885	4.5	27.7	246	0.265	0.089	MOG_MOUSE Myelin-oligodendrocyte glycoprotein OS=Mus musculus OX=10090 GN=Mog PE=1 SV=1
12	A1ZBW7	5.0	27.7	1469	0.205	0.012	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
13	P53008	7.3	27.3	833	0.217	0.022	CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
14	Q9VQW1	7.4	27.3	1198	0.205	0.014	Q9VQW1_DROME Friend of echinoid, isoform G OS=Drosophila melanogaster OX=7227 GN=fred PE=1 SV=4
15	Q381Q0	7.5	26.9	273	0.108	0.033	Q381Q0_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7000 PE=4 SV=1
16	Q78JT3	7.5	26.9	286	0.205	0.059	3HAO_MOUSE 3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus OX=10090 GN=Haao PE=1 SV=1
17	M9NCR3	8.2	26.9	1323	0.205	0.013	M9NCR3_DROME Friend of echinoid, isoform F OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
18	A0A023GPK8	8.3	26.9	1447	0.205	0.012	A0A023GPK8_DROME Friend of echinoid, isoform H OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
19	Q9N5Z3	8.5	26.9	1221	0.277	0.019	Q9N5Z3_CAEEL TIR domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tol-1 PE=1 SV=2
20	P25099	8.9	26.9	326	0.145	0.037	AA1R_RAT Adenosine receptor A1 OS=Rattus norvegicus OX=10116 GN=Adora1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20088 DUF6480	2.4e+02	13.1	Family of unknown function (DUF6480)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006047609.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006073560.1	0.701	Olfactory receptor 4Q2-like
2	89462.XP_006069502.1	0.592	Olfactory receptor 6C76-like
3	89462.XP_006072268.1	0.581	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
4	89462.XP_006052447.1	0.579	Olfactory receptor 4K3-like
5	89462.XP_006073534.1	0.579	Olfactory receptor 4K14-like
6	89462.XP_006056527.1	0.517	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.951	biological regulation
GO:0050789	0.944	regulation of biological process
GO:0032501	0.932	multicellular organismal process
GO:0050794	0.908	regulation of cellular process
GO:0009987	0.897	cellular process
GO:0032502	0.624	developmental process
GO:0048518	0.554	positive regulation of biological process
GO:0019222	0.508	regulation of metabolic process
GO:0048856	0.501	anatomical structure development
GO:0050896	0.417	response to stimulus
GO:0060255	0.395	regulation of macromolecule metabolic process
GO:0010468	0.328	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005737	0.982	cytoplasm
GO:0016020	0.843	membrane
GO:0005634	0.834	nucleus
GO:0071944	0.646	cell periphery
GO:0005886	0.600	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]