StarFunc result for job id Q9NPZ5

User Input

>input (323 residues)
MKSALFTRFFILLPWILIVIIMLDVDTRRPVPPLTPRPYFSPYAVGRGGARLPLRRGGPA
HGTQKRNQSRPQPQPEPQLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAA
ARSELVSRFLARAGLPSTHLHVPTPRRYKRPGLPRATEQRNAGLAWLRQRHQHQRAQPGV
LFFADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPF
AIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWH
TRTEKVNLANEPKYHLDTVKIEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z137	0.923	0.920	1.682E-62	324	0.901	0.898	Q9Z137.pdb.gz	B3GA2_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=B3gat2 PE=1 SV=1
2	AFDB:Q5CB07	0.746	0.737	4.550E-43	327	0.554	0.547	Q5CB07.pdb.gz
3	AFDB:O35789	0.729	0.706	7.883E-40	334	0.505	0.488	O35789.pdb.gz	B3GA1_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=B3gat1 PE=1 SV=2
4	AFDB:F8W289	0.708	0.693	1.989E-36	330	0.427	0.418	F8W289.pdb.gz	F8W289_DANRE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase OS=Danio rerio OX=7955 GN=CHUNP6865 PE=3 SV=1
5	AFDB:O94766	0.709	0.684	1.573E-35	335	0.421	0.406	O94766.pdb.gz	B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2
6	AFDB:O97422	0.691	0.729	3.611E-34	306	0.396	0.418	O97422.pdb.gz	B3GI_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I OS=Drosophila melanogaster OX=7227 GN=GlcAT-I PE=2 SV=2
7	AFDB:Q09363	0.699	0.635	9.112E-31	356	0.334	0.303	Q09363.pdb.gz	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
8	AFDB:Q9VTG7	0.667	0.456	8.169E-30	479	0.328	0.221	Q9VTG7.pdb.gz	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
9	AFDB:Q9VLA1	0.668	0.530	9.127E-27	409	0.328	0.259	Q9VLA1.pdb.gz	B3G2S_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase S OS=Drosophila melanogaster OX=7227 GN=GlcAT-S PE=1 SV=2
10	AFDB:Q5QM25	0.622	0.460	4.965E-22	446	0.241	0.175	Q5QM25.pdb.gz	IRX9L_ORYSJ Probable beta-1,4-xylosyltransferase IRX9L OS=Oryza sativa subsp. japonica OX=39947 GN=IRX9L PE=2 SV=1
11	PDB:7d72A	0.410	0.339	4.757E-7	407	0.099	0.079	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
12	PDB:7x8kB	0.375	0.338	2.750E-6	367	0.087	0.076	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
13	PDB:6fxrA	0.417	0.212	2.928E-6	700	0.077	0.036	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:7msnA	0.356	0.287	3.117E-6	417	0.090	0.070	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
15	PDB:4y63A	0.330	0.368	2.976E-5	282	0.108	0.124	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
16	PDB:7d72K	0.368	0.337	4.070E-5	360	0.090	0.081	7d72K.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
17	PDB:4fixA	0.429	0.239	4.912E-5	629	0.077	0.040	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:6h0bB	0.401	0.269	5.928E-5	521	0.130	0.081	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
19	PDB:7sckA	0.361	0.203	5.928E-5	642	0.056	0.028	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
20	PDB:2d7iA	0.379	0.248	6.720E-5	536	0.127	0.076	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NPZ5	0.0	660	323	1.000	1.000	B3GA2_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GAT2 PE=1 SV=2
2	Q9Z137	0.0	593	324	0.901	0.898	B3GA2_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=B3gat2 PE=1 SV=1
3	Q9P2W7	1.65e-97	293	334	0.471	0.455	B3GA1_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GAT1 PE=1 SV=2
4	O35789	3.03e-97	292	334	0.471	0.455	B3GA1_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=B3gat1 PE=1 SV=2
5	Q9CW73	3.03e-97	292	334	0.471	0.455	B3GA1_MOUSE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Mus musculus OX=10090 GN=B3gat1 PE=2 SV=3
6	F8W289	5.08e-89	271	330	0.437	0.427	F8W289_DANRE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase OS=Danio rerio OX=7955 GN=CHUNP6865 PE=3 SV=1
7	P58158	7.38e-78	243	335	0.409	0.394	B3GA3_MOUSE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Mus musculus OX=10090 GN=B3gat3 PE=1 SV=1
8	O94766	1.07e-77	242	335	0.409	0.394	B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2
9	O97422	4.46e-75	234	306	0.402	0.425	B3GI_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I OS=Drosophila melanogaster OX=7227 GN=GlcAT-I PE=2 SV=2
10	Q09363	3.25e-63	206	356	0.353	0.320	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
11	Q9VTG7	1.35e-57	194	479	0.303	0.205	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
12	Q9VLA1	3.90e-55	186	409	0.310	0.244	B3G2S_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase S OS=Drosophila melanogaster OX=7227 GN=GlcAT-S PE=1 SV=2
13	Q9SXC4	3.32e-29	117	394	0.248	0.203	IRX9H_ARATH Probable beta-1,4-xylosyltransferase IRX9H OS=Arabidopsis thaliana OX=3702 GN=IRX9H PE=2 SV=2
14	Q5QM25	8.37e-21	94.4	446	0.223	0.161	IRX9L_ORYSJ Probable beta-1,4-xylosyltransferase IRX9L OS=Oryza sativa subsp. japonica OX=39947 GN=IRX9L PE=2 SV=1
15	Q7XTB2	6.25e-18	85.9	381	0.214	0.181	GT43H_ORYSJ Probable glucuronosyltransferase Os04g0103100 OS=Oryza sativa subsp. japonica OX=39947 GN=GT43H PE=2 SV=2
16	Q6AT32	1.84e-17	84.7	451	0.211	0.151	GT43E_ORYSJ Probable beta-1,4-xylosyltransferase GT43E OS=Oryza sativa subsp. japonica OX=39947 GN=GT43E PE=2 SV=1
17	Q8W4Z4	7.17e-16	79.3	336	0.220	0.211	Q8W4Z4_GOSHI Glycosyltransferases (Fragment) OS=Gossypium hirsutum OX=3635 GN=f14 PE=2 SV=1
18	Q6V9S8	8.89e-16	79.3	368	0.220	0.193	Q6V9S8_GOSHI Glycosyltransferases OS=Gossypium hirsutum OX=3635 GN=GT43A1 PE=2 SV=1
19	Q653F4	2.47e-12	69.7	524	0.229	0.141	IRX14_ORYSJ Probable beta-1,4-xylosyltransferase IRX14 OS=Oryza sativa subsp. japonica OX=39947 GN=IRX14 PE=2 SV=1
20	Q9FH90	3.62e-10	63.2	492	0.152	0.100	IX14H_ARATH Probable beta-1,4-xylosyltransferase IRX14H OS=Arabidopsis thaliana OX=3702 GN=IRX14H PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03360 Glyco_transf_43	2.2e-66	235.2	Glycosyltransferase family 43

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264249	0.970	Carbohydrate sulfotransferase 10
2	9606.ENSP00000310696	0.941	Beta-1,4-galactosyltransferase 2
3	9606.ENSP00000292377	0.934	Glypican-2
4	9606.ENSP00000480428	0.919	Beta-1,4-galactosyltransferase 3
5	9606.ENSP00000359864	0.918	Glypican-4
6	9606.ENSP00000366267	0.917	Glypican-5
7	9606.ENSP00000307046	0.916	Syndecan-2
8	9606.ENSP00000344468	0.916	Syndecan-3
9	9606.ENSP00000369055	0.916	Beta-1,4-galactosyltransferase 1
10	9606.ENSP00000377836	0.914	Glypican-3
11	9606.ENSP00000252575	0.912	Neurocan core protein
12	9606.ENSP00000264039	0.912	Glypican-1
13	9606.ENSP00000331210	0.909	Brevican core protein
14	9606.ENSP00000361818	0.908	Syndecan-4
15	9606.ENSP00000366246	0.907	Glypican-6
16	9606.ENSP00000368678	0.906	Agrin
17	9606.ENSP00000363827	0.905	Basement membrane-specific heparan sulfate proteoglycan core protein
18	9606.ENSP00000265077	0.904	Versican core protein
19	9606.ENSP00000370542	0.903	Syndecan-1
20	9606.ENSP00000312506	0.902	Chondroitin sulfate proteoglycan 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015020	1.000	glucuronosyltransferase activity
GO:0015018	0.985	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity
GO:0005488	0.950	binding
GO:0005515	0.876	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901576	0.921	organic substance biosynthetic process
GO:0009987	0.778	cellular process
GO:0006807	0.639	nitrogen compound metabolic process
GO:0044237	0.624	cellular metabolic process
GO:1901564	0.613	organonitrogen compound metabolic process
GO:0005975	0.514	carbohydrate metabolic process
GO:0043170	0.432	macromolecule metabolic process
GO:1901135	0.411	carbohydrate derivative metabolic process
GO:0050896	0.317	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0043233	0.645	organelle lumen
GO:0070013	0.639	intracellular organelle lumen
GO:0005576	0.342	extracellular region
GO:0005783	0.316	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21032	1.000	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	1.000	glucuronosyltransferase.
RHEA:24168	0.985	3-O-(beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + UDP-alpha-D-glucuronate = 3-O-(beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.135	0.985	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase.

[back to server]