StarFunc result for job id Q9NQ11

User Input

>input (1180 residues)
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGI
PLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPS
PQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIETQQ
AFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPY
YGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLRDMVKLSMRVCVCRP
GGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSLTGESIPVLKTALPEG
LGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAKGGLVSSILHPRPINFK
FYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVC
TLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDGLDVMGVVPLKGQAFLPLV
PEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVESTGWVLEEEPAADSAFGTQVL
AVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELV
AGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVPSLEAAQQLTRDTVEGDLSLLG
LLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLIIVHATH
PERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKL
LPKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEA
SVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGD
LQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGY
FLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVP
FLVALALLSSVLVGLVLVPGLLQGPLALRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQ
CLPACLRRLRPKRASKKRFKQLERELAEQPWPPLPAGPLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7m5xA	0.715	0.830	0.000	1000	0.835	0.985	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
2	PDB:7vpkA	0.735	0.814	0.000	1055	0.892	0.997	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
3	AFDB:A0A0G2JX15	0.850	0.900	0.000	1114	0.761	0.806	A0A0G2JX15.pdb.gz	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2
4	AFDB:A0A2R8QKM0	0.916	0.924	0.000	1170	0.514	0.518	A0A2R8QKM0.pdb.gz
5	AFDB:F1MAA4	0.907	0.934	0.000	1145	0.831	0.857	F1MAA4.pdb.gz	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
6	AFDB:H2L3J0	0.887	0.915	0.000	1143	0.486	0.501	H2L3J0.pdb.gz	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
7	AFDB:Q9H7F0	0.881	0.849	0.000	1226	0.415	0.400	Q9H7F0.pdb.gz	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
8	AFDB:Q9NQ11	1.000	1.000	0.000	1180	1.000	1.000	Q9NQ11.pdb.gz	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
9	AFDB:Q5XF90	0.887	0.878	2.234E-99	1193	0.393	0.389	Q5XF90.pdb.gz	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
10	AFDB:Q4VNC0	0.872	0.846	2.440E-99	1218	0.394	0.382	Q4VNC0.pdb.gz	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
11	AFDB:Q4VNC1	0.898	0.886	3.463E-98	1196	0.396	0.390	Q4VNC1.pdb.gz	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
12	AFDB:Q27533	0.848	0.798	1.078E-93	1256	0.363	0.341	Q27533.pdb.gz	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
13	PDB:6xmtA	0.626	0.669	1.648E-55	1092	0.242	0.262	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.
14	PDB:7e7sA	0.527	0.600	1.410E-36	1020	0.161	0.186	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:5zmwA	0.512	0.591	1.345E-35	1000	0.157	0.185	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
16	PDB:7x20A	0.521	0.608	3.379E-33	986	0.171	0.205	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
17	PDB:8d3xA	0.510	0.590	1.013E-30	989	0.165	0.197	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
18	PDB:3ixzA	0.515	0.596	1.577E-30	998	0.165	0.195	3ixzA.pdb.gz
19	PDB:7rd6A	0.500	0.612	4.977E-30	929	0.136	0.173	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:6rohA	0.521	0.548	6.782E-30	1112	0.142	0.151	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JX15	0.0	828	1050	0.356	0.400	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2
2	A0A8I5ZTP8	0.0	1871	1133	0.806	0.839	A0A8I5ZTP8_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=1
3	A1A5E5	0.0	1117	1170	0.508	0.513	A1A5E5_DANRE Cation-transporting ATPase OS=Danio rerio OX=7955 GN=zgc:136762 PE=1 SV=1
4	B5DEH6	0.0	1946	1145	0.831	0.856	B5DEH6_RAT Cation-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=2 SV=1
5	F1MAA4	0.0	2007	1173	0.853	0.858	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
6	F5GUA7	0.0	692	1207	0.348	0.341	F5GUA7_CAEEL Cation-transporting P-type ATPase N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
7	H2L3J0	0.0	1041	1143	0.486	0.502	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
8	O74431	0.0	683	1315	0.358	0.322	ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.11c PE=3 SV=1
9	Q12697	0.0	634	1472	0.316	0.253	YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPK9 PE=1 SV=1
10	Q21286	0.0	674	1203	0.343	0.337	CATP5_CAEEL Cation-transporting ATPase catp-5 OS=Caenorhabditis elegans OX=6239 GN=catp-5 PE=2 SV=4
11	Q27533	0.0	711	1256	0.372	0.350	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
12	Q4VNC0	0.0	773	1218	0.397	0.385	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
13	Q4VNC1	0.0	771	1196	0.398	0.393	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
14	Q54X63	0.0	619	1158	0.325	0.332	Q54X63_DICDI Cation-transporting ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279183 PE=3 SV=1
15	Q5XF90	0.0	763	1193	0.393	0.389	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
16	Q8N4D4	0.0	2208	1088	0.922	1.000	Q8N4D4_HUMAN ATP13A2 protein (Fragment) OS=Homo sapiens OX=9606 GN=ATP13A2 PE=2 SV=1
17	Q9CTG6	0.0	2020	1169	0.854	0.862	AT132_MOUSE Polyamine-transporting ATPase 13A2 OS=Mus musculus OX=10090 GN=Atp13a2 PE=2 SV=3
18	Q9H7F0	0.0	858	1226	0.421	0.405	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
19	Q9NQ11	0.0	2397	1180	1.000	1.000	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
20	D3YT44	2.96e-168	523	893	0.261	0.345	D3YT44_CAEEL Cation-transporting ATPase 13A3 OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	3.3	19.1	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	2.7e-30	116.8	E1-E2 ATPase
3	PF00702 Hydrolase	1.4e-12	59.9	haloacid dehalogenase-like hydrolase
4	PF12409 P5-ATPase	1.3e-20	85.3	P5-type ATPase cation transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298910	0.905	Leucine-rich repeat serine/threonine-protein kinase 2
2	9606.ENSP00000418770	0.900	Protein/nucleic acid deglycase DJ-1
3	9606.ENSP00000364204	0.883	Serine/threonine-protein kinase PINK1, mitochondrial
4	9606.ENSP00000355865	0.868	E3 ubiquitin-protein ligase parkin
5	9606.ENSP00000299138	0.853	Vacuolar protein sorting-associated protein 35
6	9606.ENSP00000338345	0.847	Alpha-synuclein
7	9606.ENSP00000266087	0.811	F-box only protein 7
8	9606.ENSP00000333142	0.801	85/88 kDa calcium-independent phospholipase A2
9	9606.ENSP00000360108	0.740	Putative tyrosine-protein phosphatase auxilin
10	9606.ENSP00000314508	0.738	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
11	9606.ENSP00000387170	0.738	GRB10-interacting GYF protein 2
12	9606.ENSP00000313377	0.721	Pantothenate kinase 2, mitochondrial
13	9606.ENSP00000249806	0.714	CLN6, transmembrane ER protein
14	9606.ENSP00000409667	0.711	Synaptojanin-1
15	9606.ENSP00000275532	0.698	BTB/POZ domain-containing protein KCTD7
16	9606.ENSP00000366673	0.697	Ceroid-lipofuscinosis neuronal protein 5
17	9606.ENSP00000328182	0.696	Protein CLN8
18	9606.ENSP00000284440	0.690	Ubiquitin carboxyl-terminal hydrolase isozyme L1
19	9606.ENSP00000219368	0.677	Fatty acid 2-hydroxylase
20	9606.ENSP00000314499	0.676	Cyclin-G-associated kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019829	0.998	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0005515	0.996	protein binding
GO:0140358	0.831	P-type transmembrane transporter activity
GO:0022890	0.772	inorganic cation transmembrane transporter activity
GO:0015662	0.764	P-type ion transporter activity
GO:0043167	0.763	ion binding
GO:0046873	0.706	metal ion transmembrane transporter activity
GO:0008289	0.593	lipid binding
GO:1901702	0.591	salt transmembrane transporter activity
GO:0005543	0.562	phospholipid binding
GO:0035091	0.540	phosphatidylinositol binding
GO:0043168	0.501	anion binding
GO:1901981	0.466	phosphatidylinositol phosphate binding
GO:0015203	0.463	polyamine transmembrane transporter activity
GO:0080025	0.444	phosphatidylinositol-3,5-bisphosphate binding
GO:0070300	0.437	phosphatidic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0061919	0.996	process utilizing autophagic mechanism
GO:0010821	0.995	regulation of mitochondrion organization
GO:0016236	0.990	macroautophagy
GO:0016043	0.987	cellular component organization
GO:0007033	0.964	vacuole organization
GO:0065008	0.931	regulation of biological quality
GO:0090066	0.796	regulation of anatomical structure size
GO:1905037	0.738	autophagosome organization
GO:0032535	0.546	regulation of cellular component size
GO:0051234	0.528	establishment of localization
GO:0006810	0.511	transport
GO:0048518	0.464	positive regulation of biological process
GO:0019222	0.460	regulation of metabolic process
GO:0071704	0.437	organic substance metabolic process
GO:0050896	0.393	response to stimulus
GO:0048522	0.362	positive regulation of cellular process
GO:0051641	0.355	cellular localization
GO:0006807	0.338	nitrogen compound metabolic process
GO:0031323	0.327	regulation of cellular metabolic process
GO:0060255	0.317	regulation of macromolecule metabolic process
GO:0080090	0.301	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0031090	0.991	organelle membrane
GO:0005773	0.925	vacuole
GO:0098588	0.920	bounding membrane of organelle
GO:0031982	0.846	vesicle
GO:0097708	0.825	intracellular vesicle
GO:0031410	0.824	cytoplasmic vesicle
GO:0005764	0.806	lysosome
GO:0005768	0.759	endosome
GO:0042995	0.731	cell projection
GO:0012506	0.730	vesicle membrane
GO:0005829	0.723	cytosol
GO:0120025	0.720	plasma membrane bounded cell projection
GO:0030659	0.652	cytoplasmic vesicle membrane
GO:0005765	0.630	lysosomal membrane
GO:0044297	0.462	cell body
GO:0005783	0.430	endoplasmic reticulum
GO:0036477	0.415	somatodendritic compartment
GO:0043233	0.385	organelle lumen
GO:0070013	0.383	intracellular organelle lumen
GO:0043005	0.375	neuron projection
GO:0043025	0.333	neuronal cell body
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.998	Translocases.

[back to server]