StarFunc result for job id Q9NQ29

User Input

>input (371 residues)
MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECT
KIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS
AKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS
SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRN
QDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHR
RHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWRLESSNGKMAS
RRSEEKEAGEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CYI4	0.540	0.540	1.403E-41	371	0.970	0.970	Q9CYI4.pdb.gz	LUC7L_MOUSE Putative RNA-binding protein Luc7-like 1 OS=Mus musculus OX=10090 GN=Luc7l PE=1 SV=2
2	AFDB:Q7TNC4	0.737	0.698	1.012E-37	392	0.765	0.724	Q7TNC4.pdb.gz	LC7L2_MOUSE Putative RNA-binding protein Luc7-like 2 OS=Mus musculus OX=10090 GN=Luc7l2 PE=1 SV=1
3	AFDB:Q9VVI1	0.614	0.543	1.240E-28	420	0.536	0.474	Q9VVI1.pdb.gz	Q9VVI1_DROME LD04387p OS=Drosophila melanogaster OX=7227 GN=Alsin2 PE=1 SV=1
4	AFDB:J3KPP4	0.434	0.346	1.515E-17	489	0.369	0.280	J3KPP4.pdb.gz	J3KPP4_HUMAN Cisplatin resistance-associated overexpressed protein, isoform CRA_b OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=1
5	AFDB:Q9USM4	0.496	0.671	1.221E-16	264	0.243	0.341	Q9USM4.pdb.gz	LUC7_SCHPO U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp106 PE=1 SV=1
6	PDB:5zwnY	0.354	0.614	4.730E-8	196	0.186	0.352	5zwnY.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
7	PDB:6n7rI	0.341	0.793	6.173E-7	147	0.164	0.415	6n7rI.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
8	PDB:6g90H	0.334	0.698	1.798E-5	158	0.159	0.373	6g90H.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
9	AFDB:Q9Z131	0.202	0.169	4.572E-2	463	0.156	0.125	Q9Z131.pdb.gz	3BP5_MOUSE SH3 domain-binding protein 5 OS=Mus musculus OX=10090 GN=Sh3bp5 PE=1 SV=3
10	AFDB:Q54PN9	0.117	0.133	5.088E-2	324	0.105	0.120	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
11	AFDB:Q45013	0.126	0.069	1.198E-1	700	0.097	0.051	Q45013.pdb.gz	Q45013_BORBU Borrelia P83/P100 antigen OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=p83/100 PE=4 SV=2
12	AFDB:Q571B6	0.227	0.120	1.566E-1	793	0.124	0.058	Q571B6.pdb.gz	WHAMM_MOUSE WASP homolog-associated protein with actin, membranes and microtubules OS=Mus musculus OX=10090 GN=Whamm PE=1 SV=2
13	AFDB:P50947	0.114	0.126	1.743E-1	330	0.105	0.118	P50947.pdb.gz	PHO23_YEAST Transcriptional regulatory protein PHO23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO23 PE=1 SV=1
14	PDB:7myoB	0.221	0.268	2.745E-1	286	0.084	0.108	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
15	PDB:5u1dB	0.119	0.085	2.896E-1	552	0.081	0.054	5u1dB.pdb.gz
16	PDB:5u1dA	0.179	0.130	1.046	561	0.046	0.030	5u1dA.pdb.gz
17	PDB:6z6oC	0.138	0.100	1.104	548	0.057	0.038	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
18	PDB:7vwcA	0.137	0.097	1.104	617	0.065	0.039	7vwcA.pdb.gz
19	PDB:6tpiA	0.144	0.141	1.296	380	0.062	0.061	6tpiA.pdb.gz
20	PDB:7vgfA	0.177	0.132	1.367	550	0.043	0.029	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CYI4	0.0	712	371	0.970	0.970	LUC7L_MOUSE Putative RNA-binding protein Luc7-like 1 OS=Mus musculus OX=10090 GN=Luc7l PE=1 SV=2
2	Q9NQ29	0.0	733	371	1.000	1.000	LUC7L_HUMAN Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L PE=1 SV=1
3	Q9Y383	4.28e-158	451	392	0.566	0.536	LC7L2_HUMAN Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2
4	Q7TNC4	7.98e-158	450	392	0.563	0.533	LC7L2_MOUSE Putative RNA-binding protein Luc7-like 2 OS=Mus musculus OX=10090 GN=Luc7l2 PE=1 SV=1
5	Q9VVI1	6.73e-117	347	420	0.437	0.386	Q9VVI1_DROME LD04387p OS=Drosophila melanogaster OX=7227 GN=Alsin2 PE=1 SV=1
6	Q9USM4	2.15e-44	155	264	0.240	0.337	LUC7_SCHPO U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp106 PE=1 SV=1
7	Q07508	9.33e-33	125	261	0.216	0.307	LUC7_YEAST Protein LUC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LUC7 PE=1 SV=1
8	O95232	2.42e-32	127	432	0.267	0.229	LC7L3_HUMAN Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2
9	J3KPP4	7.08e-32	127	489	0.267	0.202	J3KPP4_HUMAN Cisplatin resistance-associated overexpressed protein, isoform CRA_b OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=1
10	F4IZU3	3.55e-21	96.3	402	0.197	0.182	F4IZU3_ARATH LUC7 related protein OS=Arabidopsis thaliana OX=3702 GN=UNE6 PE=1 SV=1
11	Q9W3X8	2.51e-16	82.0	438	0.137	0.116	Q9W3X8_DROME RH42690p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3198 PE=1 SV=2
12	Q63627	0.002	43.1	1200	0.097	0.030	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
13	O95104	0.023	39.3	1147	0.073	0.024	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
14	Q8IDX6	0.041	38.5	3130	0.067	0.008	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
15	F4JQG2	0.32	35.4	551	0.081	0.054	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
16	M9PE28	0.47	35.0	1641	0.111	0.025	M9PE28_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
17	E2QCS8	0.48	35.0	1642	0.111	0.025	E2QCS8_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
18	Q9VQ76	0.48	35.0	1641	0.111	0.025	Q9VQ76_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=2
19	Q9VRM6	1.0	34.3	1929	0.070	0.013	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
20	Q8SX83	2.0	33.1	5560	0.067	0.004	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03194 LUC7	4.6e-72	254.3	LUC7 N_terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010380154.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354132.1	0.993	RNA-binding protein 25
2	61622.XP_010383686.1	0.992	pre-mRNA processing factor 40 homolog B
3	61622.XP_010367740.1	0.982	U1 small nuclear ribonucleoprotein 70 kDa isoform X1
4	61622.XP_010387599.1	0.979	pre-mRNA-processing factor 39 isoform X1
5	61622.XP_010371197.1	0.976	pre-mRNA processing factor 40 homolog A
6	61622.XP_010379981.1	0.971	Small nuclear ribonucleoprotein polypeptide A
7	61622.XP_010375768.1	0.966	Small nuclear ribonucleoprotein Sm D2
8	61622.XP_010378643.1	0.962	tRNA selenocysteine 1 associated protein 1
9	61622.XP_010381248.1	0.959	Splicing factor 3B subunit 3
10	61622.XP_010353183.1	0.954	Small nuclear ribonucleoprotein Sm D1
11	61622.XP_010374612.1	0.945	Small nuclear ribonucleoprotein Sm D3
12	61622.XP_010387936.1	0.945	Small nuclear ribonucleoprotein D3 polypeptide
13	61622.XP_010360199.1	0.944	Small nuclear ribonucleoprotein G isoform X1
14	61622.XP_010379922.1	0.944	Splicing factor 3b subunit 1
15	61622.XP_010354460.1	0.943	Small nuclear ribonucleoprotein polypeptide N
16	61622.XP_010377314.1	0.943	Small nuclear ribonucleoprotein polypeptides B and B1
17	61622.XP_010351686.1	0.936	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 59 ESTs, 11 Proteins, and 86% coverage of the annotated genomic feature by RNAseq alignments
18	61622.XP_010379681.1	0.936	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
19	61622.XP_010366691.1	0.935	U11/U12 small nuclear ribonucleoprotein 35 kDa protein isoform X1
20	61622.XP_010370700.1	0.919	Necessary for the splicing of pre-mRNA.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.993	protein domain specific binding
GO:1901363	0.886	heterocyclic compound binding
GO:0097159	0.886	organic cyclic compound binding
GO:0003676	0.874	nucleic acid binding
GO:0050733	0.766	RS domain binding
GO:0003723	0.746	RNA binding
GO:0042802	0.484	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0048519	0.911	negative regulation of biological process
GO:1901861	0.897	regulation of muscle tissue development
GO:0048634	0.895	regulation of muscle organ development
GO:0008152	0.794	metabolic process
GO:0009987	0.792	cellular process
GO:0006807	0.754	nitrogen compound metabolic process
GO:0051241	0.747	negative regulation of multicellular organismal process
GO:0071704	0.718	organic substance metabolic process
GO:0044237	0.685	cellular metabolic process
GO:0043170	0.666	macromolecule metabolic process
GO:0044238	0.653	primary metabolic process
GO:0006725	0.584	cellular aromatic compound metabolic process
GO:0090304	0.570	nucleic acid metabolic process
GO:0050794	0.540	regulation of cellular process
GO:0006396	0.526	RNA processing
GO:0016071	0.489	mRNA metabolic process
GO:0008380	0.485	RNA splicing
GO:0051093	0.463	negative regulation of developmental process
GO:0000375	0.454	RNA splicing, via transesterification reactions
GO:0006397	0.400	mRNA processing
GO:0071840	0.391	cellular component organization or biogenesis
GO:0016043	0.384	cellular component organization
GO:0000377	0.380	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.304	mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.997	nuclear body
GO:0016607	0.988	nuclear speck
GO:0032991	0.964	protein-containing complex
GO:0005737	0.696	cytoplasm
GO:1990904	0.504	ribonucleoprotein complex
GO:0140513	0.432	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]