StarFunc result for job id Q9NQ30

User Input

>input (184 residues)
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
RGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKW
LNPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQ30	1.000	1.000	7.578E-36	184	1.000	1.000	Q9NQ30.pdb.gz	ESM1_HUMAN Endothelial cell-specific molecule 1 OS=Homo sapiens OX=9606 GN=ESM1 PE=1 SV=2
2	AFDB:I6XXP7	0.279	0.192	1.245E-3	291	0.223	0.141	I6XXP7.pdb.gz	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
3	PDB:7wrqB	0.276	0.301	9.381E-3	167	0.158	0.174	7wrqB.pdb.gz
4	AFDB:P59222	0.206	0.048	7.647E-1	833	0.147	0.032	P59222.pdb.gz	SREC2_MOUSE Scavenger receptor class F member 2 OS=Mus musculus OX=10090 GN=Scarf2 PE=1 SV=1
5	PDB:3bnfA	0.086	0.038	4.220	471	0.016	0.006	3bnfA.pdb.gz	Binding and Reduction of Sulfite by Cytochrome c Nitrite Reductase
6	PDB:5epmC	0.135	0.667	5.415	33	0.043	0.242	5epmC.pdb.gz
7	PDB:5w5eA	0.091	0.098	5.415	167	0.043	0.048	5w5eA.pdb.gz
8	PDB:5xohA	0.104	0.058	5.763	348	0.043	0.023	5xohA.pdb.gz	Crystal structure of bergaptol o-methyltransferase complex
9	PDB:1dw9A	0.084	0.094	6.134	156	0.027	0.032	1dw9A.pdb.gz
10	PDB:7rxbA	0.095	0.034	6.134	548	0.022	0.007	7rxbA.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
11	PDB:7wihA	0.099	0.041	6.528	741	0.098	0.024	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
12	AFDB:Q8C753	0.090	0.018	6.776	1610	0.158	0.018	Q8C753.pdb.gz	KATIP_MOUSE Katanin-interacting protein OS=Mus musculus OX=10090 GN=Katnip PE=1 SV=2
13	PDB:7d58B	0.066	0.021	7.395	1095	0.087	0.015	7d58B.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
14	PDB:3vtsA	0.128	0.241	7.871	61	0.054	0.164	3vtsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQ30	6.96e-137	381	184	1.000	1.000	ESM1_HUMAN Endothelial cell-specific molecule 1 OS=Homo sapiens OX=9606 GN=ESM1 PE=1 SV=2
2	Q6GMI0	4.52e-06	48.1	479	0.179	0.069	HTR1A_DANRE Serine protease HTRA1A OS=Danio rerio OX=7955 GN=htra1a PE=2 SV=1
3	P83105	3.07e-04	42.7	476	0.141	0.055	HTRA4_HUMAN Serine protease HTRA4 OS=Homo sapiens OX=9606 GN=HTRA4 PE=1 SV=1
4	Q7T3Q2	3.54e-04	42.7	1027	0.207	0.037	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
5	Q9QZK5	6.37e-04	42.0	480	0.141	0.054	HTRA1_RAT Serine protease HTRA1 OS=Rattus norvegicus OX=10116 GN=Htra1 PE=2 SV=1
6	Q9R118	7.53e-04	41.6	480	0.141	0.054	HTRA1_MOUSE Serine protease HTRA1 OS=Mus musculus OX=10090 GN=Htra1 PE=1 SV=2
7	Q9D236	0.001	40.8	459	0.152	0.061	HTRA3_MOUSE Serine protease HTRA3 OS=Mus musculus OX=10090 GN=Htra3 PE=1 SV=3
8	Q07079	0.003	39.7	271	0.168	0.114	IBP5_MOUSE Insulin-like growth factor-binding protein 5 OS=Mus musculus OX=10090 GN=Igfbp5 PE=1 SV=1
9	Q80V70	0.004	39.7	1572	0.141	0.017	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
10	P83110	0.006	38.9	453	0.152	0.062	HTRA3_HUMAN Serine protease HTRA3 OS=Homo sapiens OX=9606 GN=HTRA3 PE=1 SV=2
11	Q9NZV1	0.008	38.5	1036	0.158	0.028	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
12	Q9VW71	0.011	38.5	4699	0.152	0.006	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
13	B3F211	0.015	37.4	265	0.120	0.083	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
14	Q9XWD6	0.023	37.4	1111	0.147	0.024	CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans OX=6239 GN=ced-1 PE=1 SV=1
15	P24594	0.024	37.0	271	0.168	0.114	IBP5_RAT Insulin-like growth factor-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Igfbp5 PE=1 SV=1
16	Q6NW92	0.025	36.6	257	0.120	0.086	Q6NW92_DANRE Insulin-like growth factor-binding protein 7 precursor OS=Danio rerio OX=7955 GN=zgc:85888 PE=1 SV=1
17	Q64299	0.027	37.0	354	0.152	0.079	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
18	Q92743	0.030	37.0	480	0.136	0.052	HTRA1_HUMAN Serine protease HTRA1 OS=Homo sapiens OX=9606 GN=HTRA1 PE=1 SV=1
19	Q9QZQ5	0.035	36.6	351	0.179	0.094	CCN3_RAT CCN family member 3 OS=Rattus norvegicus OX=10116 GN=Ccn3 PE=1 SV=1
20	A4K8J2	0.041	36.2	244	0.120	0.090	A4K8J2_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00219 IGFBP	5e-06	38.3	Insulin-like growth factor binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003827405.2

Rank	PPI partner	STRING score	Description
1	9597.XP_003807557.1	0.712	Belongs to the integrin alpha chain family.
2	9597.XP_003826531.1	0.538	Transmembrane 4 L6 family member 18
3	9597.XP_008976627.1	0.517	Centrosomal protein 350
4	9597.XP_008950123.1	0.514	Transmembrane 4 L six family member 1
5	9597.XP_003820242.1	0.512	Serine/threonine-protein kinase Chk2
6	9597.XP_003826651.1	0.505	Delta-like protein 4
7	9597.XP_008969179.1	0.504	Golgi integral membrane protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0005178	1.000	integrin binding
GO:0005171	0.573	hepatocyte growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.997	multicellular organismal process
GO:0072359	0.989	circulatory system development
GO:0023051	0.988	regulation of signaling
GO:0010646	0.987	regulation of cell communication
GO:0042127	0.986	regulation of cell population proliferation
GO:0048522	0.986	positive regulation of cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0009653	0.979	anatomical structure morphogenesis
GO:0001525	0.970	angiogenesis
GO:0009966	0.969	regulation of signal transduction
GO:0023056	0.968	positive regulation of signaling
GO:0009967	0.956	positive regulation of signal transduction
GO:0008284	0.907	positive regulation of cell population proliferation
GO:0002040	0.893	sprouting angiogenesis
GO:0009987	0.758	cellular process
GO:0050896	0.667	response to stimulus
GO:0048519	0.411	negative regulation of biological process
GO:0048523	0.316	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005576	0.977	extracellular region
GO:0071944	0.917	cell periphery
GO:0005622	0.895	intracellular anatomical structure
GO:0005886	0.888	plasma membrane
GO:0043226	0.822	organelle
GO:0005615	0.786	extracellular space
GO:0043231	0.750	intracellular membrane-bounded organelle
GO:0005737	0.686	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]